Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3953806..3954500 | Replicon | chromosome |
| Accession | NZ_CP103521 | ||
| Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | M5S63_RS19210 | Protein ID | WP_001521903.1 |
| Coordinates | 3953806..3954204 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M5S63_RS19215 | Protein ID | WP_000554758.1 |
| Coordinates | 3954207..3954500 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3949636) | 3949636..3949716 | - | 81 | NuclAT_11 | - | - |
| - (3949636) | 3949636..3949716 | - | 81 | NuclAT_11 | - | - |
| - (3949636) | 3949636..3949716 | - | 81 | NuclAT_11 | - | - |
| - (3949636) | 3949636..3949716 | - | 81 | NuclAT_11 | - | - |
| M5S63_RS19180 (3948976) | 3948976..3950220 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| M5S63_RS19185 (3950312) | 3950312..3950770 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M5S63_RS19190 (3951031) | 3951031..3952488 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| M5S63_RS19195 (3952545) | 3952545..3952897 | - | 353 | Protein_3758 | peptide chain release factor H | - |
| M5S63_RS19200 (3952893) | 3952893..3953099 | - | 207 | Protein_3759 | RtcB family protein | - |
| M5S63_RS19205 (3953344) | 3953344..3953796 | - | 453 | WP_023144376.1 | GNAT family N-acetyltransferase | - |
| M5S63_RS19210 (3953806) | 3953806..3954204 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5S63_RS19215 (3954207) | 3954207..3954500 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5S63_RS19220 (3954552) | 3954552..3955607 | - | 1056 | WP_001226177.1 | DNA polymerase IV | - |
| M5S63_RS19225 (3955678) | 3955678..3956463 | - | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5S63_RS19230 (3956435) | 3956435..3958147 | + | 1713 | Protein_3765 | flagellar biosynthesis protein FlhA | - |
| M5S63_RS19235 (3958226) | 3958226..3958579 | + | 354 | WP_024166466.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| M5S63_RS19240 (3958636) | 3958636..3959385 | - | 750 | WP_016233951.1 | C40 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3943743..3954500 | 10757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T255307 WP_001521903.1 NZ_CP103521:c3954204-3953806 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |