Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3953806..3954500 Replicon chromosome
Accession NZ_CP103521
Organism Escherichia coli strain 2779 - blood draw same patient as MB9267

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag M5S63_RS19210 Protein ID WP_001521903.1
Coordinates 3953806..3954204 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag M5S63_RS19215 Protein ID WP_000554758.1
Coordinates 3954207..3954500 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3949636) 3949636..3949716 - 81 NuclAT_11 - -
- (3949636) 3949636..3949716 - 81 NuclAT_11 - -
- (3949636) 3949636..3949716 - 81 NuclAT_11 - -
- (3949636) 3949636..3949716 - 81 NuclAT_11 - -
M5S63_RS19180 (3948976) 3948976..3950220 - 1245 WP_000189541.1 esterase FrsA -
M5S63_RS19185 (3950312) 3950312..3950770 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
M5S63_RS19190 (3951031) 3951031..3952488 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M5S63_RS19195 (3952545) 3952545..3952897 - 353 Protein_3758 peptide chain release factor H -
M5S63_RS19200 (3952893) 3952893..3953099 - 207 Protein_3759 RtcB family protein -
M5S63_RS19205 (3953344) 3953344..3953796 - 453 WP_023144376.1 GNAT family N-acetyltransferase -
M5S63_RS19210 (3953806) 3953806..3954204 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M5S63_RS19215 (3954207) 3954207..3954500 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M5S63_RS19220 (3954552) 3954552..3955607 - 1056 WP_001226177.1 DNA polymerase IV -
M5S63_RS19225 (3955678) 3955678..3956463 - 786 WP_000207556.1 putative lateral flagellar export/assembly protein LafU -
M5S63_RS19230 (3956435) 3956435..3958147 + 1713 Protein_3765 flagellar biosynthesis protein FlhA -
M5S63_RS19235 (3958226) 3958226..3958579 + 354 WP_024166466.1 type II toxin-antitoxin system HicB family antitoxin -
M5S63_RS19240 (3958636) 3958636..3959385 - 750 WP_016233951.1 C40 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3943743..3954500 10757


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T255307 WP_001521903.1 NZ_CP103521:c3954204-3953806 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT255307 WP_000554758.1 NZ_CP103521:c3954500-3954207 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References