Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 624583..625382 | Replicon | chromosome |
Accession | NZ_CP103521 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D3GWU5 |
Locus tag | M5S63_RS02990 | Protein ID | WP_000347272.1 |
Coordinates | 624583..625047 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M5S63_RS02995 | Protein ID | WP_001307405.1 |
Coordinates | 625047..625382 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS02960 (619584) | 619584..620018 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5S63_RS02965 (620036) | 620036..620914 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5S63_RS02970 (620904) | 620904..621683 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5S63_RS02975 (621694) | 621694..622167 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5S63_RS02980 (622190) | 622190..623470 | - | 1281 | WP_001521382.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5S63_RS02985 (623719) | 623719..624528 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
M5S63_RS02990 (624583) | 624583..625047 | - | 465 | WP_000347272.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5S63_RS02995 (625047) | 625047..625382 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5S63_RS03000 (625531) | 625531..627102 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
M5S63_RS03005 (627477) | 627477..628811 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5S63_RS03010 (628827) | 628827..629597 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 624583..636034 | 11451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.26 Da Isoelectric Point: 9.6924
>T255289 WP_000347272.1 NZ_CP103521:c625047-624583 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829KUD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |