Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3655385..3656079 | Replicon | chromosome |
| Accession | NZ_CP103515 | ||
| Organism | Escherichia coli strain 5444 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | M5S96_RS17945 | Protein ID | WP_001263489.1 |
| Coordinates | 3655385..3655783 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M5S96_RS17950 | Protein ID | WP_000554758.1 |
| Coordinates | 3655786..3656079 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3650973) | 3650973..3651053 | - | 81 | NuclAT_11 | - | - |
| - (3650973) | 3650973..3651053 | - | 81 | NuclAT_11 | - | - |
| - (3650973) | 3650973..3651053 | - | 81 | NuclAT_11 | - | - |
| - (3650973) | 3650973..3651053 | - | 81 | NuclAT_11 | - | - |
| M5S96_RS17920 (3651649) | 3651649..3652107 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M5S96_RS17925 (3652368) | 3652368..3653825 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| M5S96_RS17930 (3653882) | 3653882..3654403 | - | 522 | Protein_3507 | peptide chain release factor H | - |
| M5S96_RS17935 (3654399) | 3654399..3654605 | - | 207 | Protein_3508 | RtcB family protein | - |
| M5S96_RS17940 (3654923) | 3654923..3655375 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| M5S96_RS17945 (3655385) | 3655385..3655783 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5S96_RS17950 (3655786) | 3655786..3656079 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5S96_RS17955 (3656131) | 3656131..3657186 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M5S96_RS17960 (3657257) | 3657257..3658042 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5S96_RS17965 (3658014) | 3658014..3659726 | + | 1713 | Protein_3514 | flagellar biosynthesis protein FlhA | - |
| M5S96_RS17970 (3659950) | 3659950..3660447 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3655385..3670665 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T255275 WP_001263489.1 NZ_CP103515:c3655783-3655385 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |