Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 119275..119932 Replicon plasmid pMB9306_2
Accession NZ_CP103514
Organism Klebsiella pneumoniae strain 5531

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag M5S57_RS28305 Protein ID WP_000270043.1
Coordinates 119275..119625 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M5S57_RS28310 Protein ID WP_000124640.1
Coordinates 119630..119932 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S57_RS28270 (M5S57_28270) 115749..116246 - 498 WP_000062185.1 hypothetical protein -
M5S57_RS28275 (M5S57_28275) 116249..116737 - 489 WP_001273096.1 DUF1643 domain-containing protein -
M5S57_RS28280 (M5S57_28280) 116834..117169 + 336 WP_000683476.1 hypothetical protein -
M5S57_RS28285 (M5S57_28285) 117184..117654 - 471 WP_001281821.1 hypothetical protein -
M5S57_RS28290 (M5S57_28290) 117647..118018 - 372 WP_000516916.1 hypothetical protein -
M5S57_RS28295 (M5S57_28295) 118029..118223 - 195 WP_000343597.1 hypothetical protein -
M5S57_RS28300 (M5S57_28300) 118564..119112 - 549 WP_001061574.1 transcriptional regulator -
M5S57_RS28305 (M5S57_28305) 119275..119625 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S57_RS28310 (M5S57_28310) 119630..119932 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
M5S57_RS28315 (M5S57_28315) 119959..120252 - 294 WP_001239997.1 chromosome segregation protein ParM -
M5S57_RS28320 (M5S57_28320) 120340..120612 - 273 WP_001043047.1 HU family DNA-binding protein -
M5S57_RS28325 (M5S57_28325) 120670..121197 - 528 WP_001236377.1 thermonuclease family protein -
M5S57_RS28330 (M5S57_28330) 121428..122285 - 858 WP_001167032.1 hypothetical protein -
M5S57_RS28335 (M5S57_28335) 122272..122502 - 231 WP_000972663.1 hypothetical protein -
M5S57_RS28340 (M5S57_28340) 122502..123020 - 519 WP_000210756.1 nitrite reductase -
M5S57_RS28345 (M5S57_28345) 123017..123463 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
M5S57_RS28350 (M5S57_28350) 123463..123822 - 360 WP_000422768.1 hypothetical protein -
M5S57_RS28355 (M5S57_28355) 123879..124307 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / blaTEM-1B / blaCTX-M-15 / mph(A) / sul2 / floR / qnrS1 / catA2 / aph(3')-Ia / sul1 / blaDHA-1 / qacE / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / dfrA14 / aac(6')-Ib-cr - 1..190614 190614
- inside Integron - - 1..190595 190594


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T255260 WP_000270043.1 NZ_CP103514:119275-119625 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT255260 WP_000124640.1 NZ_CP103514:119630-119932 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References