Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 119275..119932 | Replicon | plasmid pMB9306_2 |
| Accession | NZ_CP103514 | ||
| Organism | Klebsiella pneumoniae strain 5531 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | M5S57_RS28305 | Protein ID | WP_000270043.1 |
| Coordinates | 119275..119625 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5S57_RS28310 | Protein ID | WP_000124640.1 |
| Coordinates | 119630..119932 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S57_RS28270 (M5S57_28270) | 115749..116246 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| M5S57_RS28275 (M5S57_28275) | 116249..116737 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| M5S57_RS28280 (M5S57_28280) | 116834..117169 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| M5S57_RS28285 (M5S57_28285) | 117184..117654 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| M5S57_RS28290 (M5S57_28290) | 117647..118018 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| M5S57_RS28295 (M5S57_28295) | 118029..118223 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| M5S57_RS28300 (M5S57_28300) | 118564..119112 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| M5S57_RS28305 (M5S57_28305) | 119275..119625 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S57_RS28310 (M5S57_28310) | 119630..119932 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| M5S57_RS28315 (M5S57_28315) | 119959..120252 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| M5S57_RS28320 (M5S57_28320) | 120340..120612 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| M5S57_RS28325 (M5S57_28325) | 120670..121197 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| M5S57_RS28330 (M5S57_28330) | 121428..122285 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| M5S57_RS28335 (M5S57_28335) | 122272..122502 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| M5S57_RS28340 (M5S57_28340) | 122502..123020 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| M5S57_RS28345 (M5S57_28345) | 123017..123463 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| M5S57_RS28350 (M5S57_28350) | 123463..123822 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| M5S57_RS28355 (M5S57_28355) | 123879..124307 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / blaTEM-1B / blaCTX-M-15 / mph(A) / sul2 / floR / qnrS1 / catA2 / aph(3')-Ia / sul1 / blaDHA-1 / qacE / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / dfrA14 / aac(6')-Ib-cr | - | 1..190614 | 190614 | |
| - | inside | Integron | - | - | 1..190595 | 190594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T255260 WP_000270043.1 NZ_CP103514:119275-119625 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|