Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 57417..58144 Replicon plasmid pMB9306_1
Accession NZ_CP103513
Organism Klebsiella pneumoniae strain 5531

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag M5S57_RS26640 Protein ID WP_011251285.1
Coordinates 57833..58144 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M5S57_RS26635 Protein ID WP_011251286.1
Coordinates 57417..57836 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S57_RS26605 (M5S57_26605) 52585..53055 - 471 WP_048333570.1 hypothetical protein -
M5S57_RS26610 (M5S57_26610) 53368..54003 - 636 WP_223171879.1 hypothetical protein -
M5S57_RS26615 (M5S57_26615) 54422..55042 + 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
M5S57_RS26620 (M5S57_26620) 55063..55851 + 789 WP_040217257.1 hypothetical protein -
M5S57_RS26625 (M5S57_26625) 55865..56230 + 366 WP_048333448.1 hypothetical protein -
M5S57_RS26630 (M5S57_26630) 56302..57270 - 969 WP_074428168.1 IS5 family transposase -
M5S57_RS26635 (M5S57_26635) 57417..57836 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
M5S57_RS26640 (M5S57_26640) 57833..58144 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
M5S57_RS26645 (M5S57_26645) 58349..58786 - 438 Protein_58 DDE-type integrase/transposase/recombinase -
M5S57_RS26650 (M5S57_26650) 58921..59618 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
M5S57_RS26655 (M5S57_26655) 59620..60069 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
M5S57_RS26660 (M5S57_26660) 60086..60397 + 312 WP_011251282.1 hypothetical protein -
M5S57_RS26665 (M5S57_26665) 60411..60752 + 342 WP_011251281.1 hypothetical protein -
M5S57_RS26670 (M5S57_26670) 60812..61768 + 957 WP_011251280.1 DsbA family protein -
M5S57_RS26675 (M5S57_26675) 61885..62460 + 576 WP_074424927.1 hypothetical protein -
M5S57_RS26680 (M5S57_26680) 62568..63083 + 516 WP_041937820.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..230429 230429
- inside IScluster/Tn - - 47296..59618 12322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T255257 WP_011251285.1 NZ_CP103513:c58144-57833 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT255257 WP_011251286.1 NZ_CP103513:c57836-57417 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References