Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 81852..82094 | Replicon | plasmid pMB9366_1 |
| Accession | NZ_CP103509 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M5T03_RS25000 | Protein ID | WP_001372321.1 |
| Coordinates | 81852..81977 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 82054..82094 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS24955 (76963) | 76963..77190 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| M5T03_RS24960 (77278) | 77278..77955 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| M5T03_RS24965 (78089) | 78089..78472 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5T03_RS24970 (78803) | 78803..79405 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| M5T03_RS24975 (79702) | 79702..80523 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| M5T03_RS24980 (80642) | 80642..80930 | - | 289 | Protein_94 | hypothetical protein | - |
| M5T03_RS24985 (80955) | 80955..81161 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| M5T03_RS24990 (81231) | 81231..81404 | + | 174 | Protein_96 | hypothetical protein | - |
| M5T03_RS24995 (81402) | 81402..81632 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| M5T03_RS25000 (81852) | 81852..81977 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M5T03_RS25005 (81919) | 81919..82068 | - | 150 | Protein_99 | plasmid maintenance protein Mok | - |
| - (82054) | 82054..82094 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (82054) | 82054..82094 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (82054) | 82054..82094 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (82054) | 82054..82094 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (83538) | 83538..83724 | - | 187 | NuclAT_0 | - | - |
| - (83538) | 83538..83724 | - | 187 | NuclAT_0 | - | - |
| - (83538) | 83538..83724 | - | 187 | NuclAT_0 | - | - |
| - (83538) | 83538..83724 | - | 187 | NuclAT_0 | - | - |
| M5T03_RS25015 (83693) | 83693..84455 | - | 763 | Protein_101 | plasmid SOS inhibition protein A | - |
| M5T03_RS25020 (84452) | 84452..84886 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| M5T03_RS25025 (84941) | 84941..86899 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-52B | senB | 1..111292 | 111292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T255240 WP_001372321.1 NZ_CP103509:c81977-81852 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT255240 NZ_CP103509:c82094-82054 [Escherichia coli O25b:H4-ST131]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
