Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4789113..4789715 | Replicon | chromosome |
| Accession | NZ_CP103508 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | M5T03_RS23495 | Protein ID | WP_000897302.1 |
| Coordinates | 4789404..4789715 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5T03_RS23490 | Protein ID | WP_000356397.1 |
| Coordinates | 4789113..4789403 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS23460 (4784420) | 4784420..4785349 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| M5T03_RS23465 (4785531) | 4785531..4785773 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| M5T03_RS23470 (4786063) | 4786063..4786911 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| M5T03_RS23475 (4786936) | 4786936..4787676 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| M5T03_RS23480 (4787861) | 4787861..4788079 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| M5T03_RS23485 (4788476) | 4788476..4788754 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| M5T03_RS23490 (4789113) | 4789113..4789403 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| M5T03_RS23495 (4789404) | 4789404..4789715 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| M5T03_RS23500 (4789944) | 4789944..4790852 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| M5T03_RS23505 (4790916) | 4790916..4791857 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M5T03_RS23510 (4791902) | 4791902..4792339 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| M5T03_RS23515 (4792336) | 4792336..4793208 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| M5T03_RS23520 (4793202) | 4793202..4793801 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T255235 WP_000897302.1 NZ_CP103508:c4789715-4789404 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|