Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 1851929..1852431 | Replicon | chromosome |
| Accession | NZ_CP103508 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | E2QNP2 |
| Locus tag | M5T03_RS08760 | Protein ID | WP_000767819.1 |
| Coordinates | 1852177..1852431 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | E2QNP3 |
| Locus tag | M5T03_RS08755 | Protein ID | WP_001259253.1 |
| Coordinates | 1851929..1852180 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS08730 (1847107) | 1847107..1848174 | - | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| M5T03_RS08735 (1848174) | 1848174..1849244 | - | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
| M5T03_RS08740 (1849241) | 1849241..1850545 | - | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
| M5T03_RS08745 (1850551) | 1850551..1851450 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| M5T03_RS08750 (1851596) | 1851596..1851646 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
| M5T03_RS08755 (1851929) | 1851929..1852180 | + | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| M5T03_RS08760 (1852177) | 1852177..1852431 | + | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| M5T03_RS08765 (1852514) | 1852514..1853338 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| M5T03_RS08770 (1853384) | 1853384..1854313 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
| M5T03_RS08775 (1854528) | 1854528..1854590 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
| M5T03_RS08780 (1854580) | 1854580..1855938 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
| M5T03_RS08785 (1856155) | 1856155..1856613 | + | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1856155..1856613 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T255220 WP_000767819.1 NZ_CP103508:1852177-1852431 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|