Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 60165..60429 | Replicon | plasmid pMB9481_2 |
Accession | NZ_CP103505 | ||
Organism | Klebsiella pneumoniae strain 5547 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | - |
Locus tag | M5R16_RS27735 | Protein ID | WP_024179505.1 |
Coordinates | 60165..60317 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 60369..60429 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R16_RS27720 (56997) | 56997..57659 | + | 663 | WP_060527638.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
M5R16_RS27725 (57731) | 57731..57940 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
M5R16_RS27730 (58333) | 58333..58509 | + | 177 | WP_180335155.1 | hypothetical protein | - |
- (59398) | 59398..59449 | + | 52 | NuclAT_1 | - | - |
- (59398) | 59398..59449 | + | 52 | NuclAT_1 | - | - |
- (59398) | 59398..59449 | + | 52 | NuclAT_1 | - | - |
- (59398) | 59398..59449 | + | 52 | NuclAT_1 | - | - |
M5R16_RS27735 (60165) | 60165..60317 | - | 153 | WP_024179505.1 | Hok/Gef family protein | Toxin |
- (60369) | 60369..60429 | + | 61 | NuclAT_0 | - | Antitoxin |
- (60369) | 60369..60429 | + | 61 | NuclAT_0 | - | Antitoxin |
- (60369) | 60369..60429 | + | 61 | NuclAT_0 | - | Antitoxin |
- (60369) | 60369..60429 | + | 61 | NuclAT_0 | - | Antitoxin |
M5R16_RS27740 (60609) | 60609..61817 | + | 1209 | WP_064148469.1 | IncI1-type conjugal transfer protein TrbA | - |
M5R16_RS27745 (61836) | 61836..62906 | + | 1071 | WP_064148470.1 | IncI1-type conjugal transfer protein TrbB | - |
M5R16_RS27750 (62899) | 62899..65190 | + | 2292 | WP_077265944.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..87513 | 87513 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5743.07 Da Isoelectric Point: 8.7948
>T255211 WP_024179505.1 NZ_CP103505:c60317-60165 [Klebsiella pneumoniae]
MPQRTFLMMLIVVCVTILCFVWIVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWIVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT255211 NZ_CP103505:60369-60429 [Klebsiella pneumoniae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|