Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 37828..38552 Replicon plasmid pMB9509_2
Accession NZ_CP103501
Organism Klebsiella pneumoniae strain 5589

Toxin (Protein)


Gene name higB Uniprot ID A0A2J4YLV3
Locus tag M5S52_RS27105 Protein ID WP_023292165.1
Coordinates 37828..38139 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A7G3NP42
Locus tag M5S52_RS27110 Protein ID WP_023317816.1
Coordinates 38136..38552 (+) Length 139 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S52_RS27060 (M5S52_27060) 33041..33472 + 432 WP_004152657.1 conjugation system SOS inhibitor PsiB -
M5S52_RS27065 (M5S52_27065) 33469..34191 + 723 WP_022631512.1 plasmid SOS inhibition protein A -
M5S52_RS27070 (M5S52_27070) 34195..34518 + 324 WP_004199367.1 hypothetical protein -
M5S52_RS27075 (M5S52_27075) 34629..35003 + 375 WP_050584024.1 hypothetical protein -
M5S52_RS27080 (M5S52_27080) 35079..35375 + 297 WP_023317812.1 hypothetical protein -
M5S52_RS27085 (M5S52_27085) 36031..36303 + 273 WP_023317813.1 hypothetical protein -
M5S52_RS27090 (M5S52_27090) 36300..36650 + 351 WP_104513727.1 hypothetical protein -
M5S52_RS27095 (M5S52_27095) 37280..37486 + 207 WP_023317814.1 hypothetical protein -
M5S52_RS27100 (M5S52_27100) 37497..37721 + 225 WP_023317815.1 hypothetical protein -
M5S52_RS27105 (M5S52_27105) 37828..38139 + 312 WP_023292165.1 type II toxin-antitoxin system HigB family toxin Toxin
M5S52_RS27110 (M5S52_27110) 38136..38552 + 417 WP_023317816.1 helix-turn-helix domain-containing protein Antitoxin
M5S52_RS27115 (M5S52_27115) 39387..39740 + 354 WP_023317817.1 hypothetical protein -
M5S52_RS27120 (M5S52_27120) 39797..40144 + 348 WP_023317818.1 hypothetical protein -
M5S52_RS27125 (M5S52_27125) 40239..40385 + 147 WP_004152750.1 hypothetical protein -
M5S52_RS27130 (M5S52_27130) 40435..41268 + 834 WP_023317819.1 N-6 DNA methylase -
M5S52_RS27135 (M5S52_27135) 42086..42907 + 822 WP_023317820.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..76999 76999


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Antitoxin HigA

(5-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12497.32 Da        Isoelectric Point: 9.9242

>T255194 WP_023292165.1 NZ_CP103501:37828-38139 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE

Download         Length: 312 bp

Antitoxin


Download         Length: 139 a.a.        Molecular weight: 15458.60 Da        Isoelectric Point: 4.4803

>AT255194 WP_023317816.1 NZ_CP103501:38136-38552 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD

Download         Length: 417 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4YLV3

Antitoxin

Source ID Structure
AlphaFold DB A0A7G3NP42

References