Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 37828..38552 | Replicon | plasmid pMB9509_2 |
| Accession | NZ_CP103501 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J4YLV3 |
| Locus tag | M5S52_RS27105 | Protein ID | WP_023292165.1 |
| Coordinates | 37828..38139 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A7G3NP42 |
| Locus tag | M5S52_RS27110 | Protein ID | WP_023317816.1 |
| Coordinates | 38136..38552 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S52_RS27060 (M5S52_27060) | 33041..33472 | + | 432 | WP_004152657.1 | conjugation system SOS inhibitor PsiB | - |
| M5S52_RS27065 (M5S52_27065) | 33469..34191 | + | 723 | WP_022631512.1 | plasmid SOS inhibition protein A | - |
| M5S52_RS27070 (M5S52_27070) | 34195..34518 | + | 324 | WP_004199367.1 | hypothetical protein | - |
| M5S52_RS27075 (M5S52_27075) | 34629..35003 | + | 375 | WP_050584024.1 | hypothetical protein | - |
| M5S52_RS27080 (M5S52_27080) | 35079..35375 | + | 297 | WP_023317812.1 | hypothetical protein | - |
| M5S52_RS27085 (M5S52_27085) | 36031..36303 | + | 273 | WP_023317813.1 | hypothetical protein | - |
| M5S52_RS27090 (M5S52_27090) | 36300..36650 | + | 351 | WP_104513727.1 | hypothetical protein | - |
| M5S52_RS27095 (M5S52_27095) | 37280..37486 | + | 207 | WP_023317814.1 | hypothetical protein | - |
| M5S52_RS27100 (M5S52_27100) | 37497..37721 | + | 225 | WP_023317815.1 | hypothetical protein | - |
| M5S52_RS27105 (M5S52_27105) | 37828..38139 | + | 312 | WP_023292165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M5S52_RS27110 (M5S52_27110) | 38136..38552 | + | 417 | WP_023317816.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M5S52_RS27115 (M5S52_27115) | 39387..39740 | + | 354 | WP_023317817.1 | hypothetical protein | - |
| M5S52_RS27120 (M5S52_27120) | 39797..40144 | + | 348 | WP_023317818.1 | hypothetical protein | - |
| M5S52_RS27125 (M5S52_27125) | 40239..40385 | + | 147 | WP_004152750.1 | hypothetical protein | - |
| M5S52_RS27130 (M5S52_27130) | 40435..41268 | + | 834 | WP_023317819.1 | N-6 DNA methylase | - |
| M5S52_RS27135 (M5S52_27135) | 42086..42907 | + | 822 | WP_023317820.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76999 | 76999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12497.32 Da Isoelectric Point: 9.9242
>T255194 WP_023292165.1 NZ_CP103501:37828-38139 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15458.60 Da Isoelectric Point: 4.4803
>AT255194 WP_023317816.1 NZ_CP103501:38136-38552 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4YLV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G3NP42 |