Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3538299..3538974 | Replicon | chromosome |
| Accession | NZ_CP103494 | ||
| Organism | Enterobacter hormaechei strain 70 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5T15_RS16840 | Protein ID | WP_259429671.1 |
| Coordinates | 3538299..3538598 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0PXC9 |
| Locus tag | M5T15_RS16845 | Protein ID | WP_015571639.1 |
| Coordinates | 3538609..3538974 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T15_RS16830 (M5T15_16830) | 3534676..3536868 | + | 2193 | WP_032669347.1 | type I secretion system permease/ATPase | - |
| M5T15_RS16835 (M5T15_16835) | 3536849..3538048 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| M5T15_RS16840 (M5T15_16840) | 3538299..3538598 | + | 300 | WP_259429671.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T15_RS16845 (M5T15_16845) | 3538609..3538974 | + | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
| M5T15_RS16850 (M5T15_16850) | 3539001..3540182 | - | 1182 | WP_017382758.1 | PLP-dependent aminotransferase family protein | - |
| M5T15_RS16855 (M5T15_16855) | 3540203..3541090 | - | 888 | WP_015571641.1 | LysR family transcriptional regulator | - |
| M5T15_RS16860 (M5T15_16860) | 3541188..3541790 | + | 603 | WP_033487546.1 | short chain dehydrogenase | - |
| M5T15_RS16865 (M5T15_16865) | 3541787..3542518 | - | 732 | WP_045141885.1 | methyltransferase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11651.31 Da Isoelectric Point: 9.6776
>T255176 WP_259429671.1 NZ_CP103494:3538299-3538598 [Enterobacter hormaechei]
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT255176 WP_015571639.1 NZ_CP103494:3538609-3538974 [Enterobacter hormaechei]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|