Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 61496..61765 | Replicon | plasmid pMB9635_2 |
Accession | NZ_CP103481 | ||
Organism | Escherichia coli strain 4621 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | M5T46_RS25905 | Protein ID | WP_001372321.1 |
Coordinates | 61640..61765 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 61496..61561 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T46_RS25865 | 56553..56819 | + | 267 | WP_071828223.1 | hypothetical protein | - |
M5T46_RS25870 | 57289..57816 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
M5T46_RS25875 | 57872..58105 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
M5T46_RS25880 | 58164..60122 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
M5T46_RS25885 | 60177..60611 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
M5T46_RS25890 | 60608..61370 | + | 763 | Protein_82 | plasmid SOS inhibition protein A | - |
M5T46_RS25895 | 61339..61527 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 61339..61563 | + | 225 | NuclAT_0 | - | - |
- | 61339..61563 | + | 225 | NuclAT_0 | - | - |
- | 61339..61563 | + | 225 | NuclAT_0 | - | - |
- | 61339..61563 | + | 225 | NuclAT_0 | - | - |
- | 61496..61561 | - | 66 | - | - | Antitoxin |
M5T46_RS25900 | 61549..61698 | + | 150 | Protein_84 | plasmid maintenance protein Mok | - |
M5T46_RS25905 | 61640..61765 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
M5T46_RS25910 | 61985..62215 | + | 231 | WP_071587244.1 | hypothetical protein | - |
M5T46_RS25915 | 62213..62386 | - | 174 | Protein_87 | hypothetical protein | - |
M5T46_RS25920 | 62684..62971 | + | 288 | WP_000107537.1 | hypothetical protein | - |
M5T46_RS25925 | 63092..63913 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
M5T46_RS25930 | 64210..64812 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
M5T46_RS25935 | 65135..65518 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
M5T46_RS25940 | 65712..66383 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
M5T46_RS25945 | 66520..66747 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T255154 WP_001372321.1 NZ_CP103481:61640-61765 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT255154 NZ_CP103481:c61561-61496 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|