Detailed information of TA system TA255154

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 61496..61765
• Replicon: plasmid pMB9635_2
• Accession: NZ_CP103481
• Organism: Escherichia coli strain 4621

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T46_RS25905
• Protein ID: WP_001372321.1
• Coordinates: 61640..61765 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	61496..61561 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T46_RS25865	56553..56819	+	267	WP_071828223.1	hypothetical protein	-
M5T46_RS25870	57289..57816	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
M5T46_RS25875	57872..58105	+	234	WP_000006004.1	DUF905 domain-containing protein	-
M5T46_RS25880	58164..60122	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
M5T46_RS25885	60177..60611	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
M5T46_RS25890	60608..61370	+	763	Protein_82	plasmid SOS inhibition protein A	-
M5T46_RS25895	61339..61527	-	189	WP_001299721.1	hypothetical protein	-
-	61339..61563	+	225	NuclAT_0	-	-
-	61339..61563	+	225	NuclAT_0	-	-
-	61339..61563	+	225	NuclAT_0	-	-
-	61339..61563	+	225	NuclAT_0	-	-
-	61496..61561	-	66	-	-	Antitoxin
M5T46_RS25900	61549..61698	+	150	Protein_84	plasmid maintenance protein Mok	-
M5T46_RS25905	61640..61765	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T46_RS25910	61985..62215	+	231	WP_071587244.1	hypothetical protein	-
M5T46_RS25915	62213..62386	-	174	Protein_87	hypothetical protein	-
M5T46_RS25920	62684..62971	+	288	WP_000107537.1	hypothetical protein	-
M5T46_RS25925	63092..63913	+	822	WP_001234469.1	DUF932 domain-containing protein	-
M5T46_RS25930	64210..64812	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
M5T46_RS25935	65135..65518	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T46_RS25940	65712..66383	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
M5T46_RS25945	66520..66747	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255154 WP_001372321.1 NZ_CP103481:61640-61765 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT255154 NZ_CP103481:c61561-61496 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin