Detailed information of TA system TA255148

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 15788..16057
• Replicon: plasmid pMB9635_1
• Accession: NZ_CP103480
• Organism: Escherichia coli strain 4621

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T46_RS24690
• Protein ID: WP_001372321.1
• Coordinates: 15932..16057 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	15788..15853 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T46_RS24635	11892..12457	+	566	Protein_15	class I SAM-dependent methyltransferase	-
M5T46_RS24640	12483..12707	+	225	WP_016238251.1	hypothetical protein	-
M5T46_RS24645	12608..12877	+	270	WP_071977877.1	hypothetical protein	-
M5T46_RS24650	13117..13323	+	207	WP_000275856.1	hypothetical protein	-
M5T46_RS24655	13349..13888	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5T46_RS24660	13956..14189	+	234	WP_000005990.1	DUF905 family protein	-
M5T46_RS24665	14217..14414	+	198	Protein_21	hypothetical protein	-
M5T46_RS24670	14469..14903	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
M5T46_RS24675	14900..15662	+	763	Protein_23	plasmid SOS inhibition protein A	-
M5T46_RS24680	15631..15819	-	189	WP_001299721.1	hypothetical protein	-
-	15631..15855	+	225	NuclAT_0	-	-
-	15631..15855	+	225	NuclAT_0	-	-
-	15631..15855	+	225	NuclAT_0	-	-
-	15631..15855	+	225	NuclAT_0	-	-
-	15788..15853	-	66	-	-	Antitoxin
M5T46_RS24685	15841..15990	+	150	Protein_25	plasmid maintenance protein Mok	-
M5T46_RS24690	15932..16057	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T46_RS24695	16277..16507	+	231	WP_071886920.1	hypothetical protein	-
M5T46_RS24700	16505..16677	-	173	Protein_28	hypothetical protein	-
M5T46_RS24705	16747..16953	+	207	WP_000547968.1	hypothetical protein	-
M5T46_RS24710	16978..17265	+	288	WP_000107535.1	hypothetical protein	-
M5T46_RS24715	17383..18204	+	822	WP_001234426.1	DUF932 domain-containing protein	-
M5T46_RS24720	18501..19103	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
M5T46_RS24725	19424..19807	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T46_RS24730	19994..20683	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(B) / blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / sitABCD	-	1..143132	143132

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255148 WP_001372321.1 NZ_CP103480:15932-16057 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT255148 NZ_CP103480:c15853-15788 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin