Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4063251..4063945 | Replicon | chromosome |
Accession | NZ_CP103479 | ||
Organism | Escherichia coli strain 4621 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | V0YKG6 |
Locus tag | M5T46_RS19395 | Protein ID | WP_001263485.1 |
Coordinates | 4063251..4063649 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M5T46_RS19400 | Protein ID | WP_000554758.1 |
Coordinates | 4063652..4063945 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T46_RS19365 (4058385) | 4058385..4059842 | + | 1458 | WP_001293011.1 | cytosol nonspecific dipeptidase | - |
M5T46_RS19370 (4059851) | 4059851..4060132 | + | 282 | WP_000106438.1 | hypothetical protein | - |
M5T46_RS19375 (4060149) | 4060149..4060658 | - | 510 | WP_000469793.1 | metal-dependent hydrolase | - |
M5T46_RS19380 (4060720) | 4060720..4061334 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
M5T46_RS19385 (4061331) | 4061331..4062470 | - | 1140 | WP_000521554.1 | RNA ligase RtcB family protein | - |
M5T46_RS19390 (4062789) | 4062789..4063241 | - | 453 | WP_001059900.1 | GNAT family N-acetyltransferase | - |
M5T46_RS19395 (4063251) | 4063251..4063649 | - | 399 | WP_001263485.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5T46_RS19400 (4063652) | 4063652..4063945 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5T46_RS19405 (4063997) | 4063997..4065052 | - | 1056 | WP_001226177.1 | DNA polymerase IV | - |
M5T46_RS19410 (4065123) | 4065123..4065908 | - | 786 | WP_000207541.1 | putative lateral flagellar export/assembly protein LafU | - |
M5T46_RS19415 (4065880) | 4065880..4067592 | + | 1713 | Protein_3805 | flagellar biosynthesis protein FlhA | - |
M5T46_RS19420 (4067690) | 4067690..4068439 | - | 750 | WP_000093945.1 | C40 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15418.84 Da Isoelectric Point: 7.3840
>T255140 WP_001263485.1 NZ_CP103479:c4063649-4063251 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|