Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1296481..1297208 | Replicon | chromosome |
| Accession | NZ_CP103479 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | M5T46_RS06305 | Protein ID | WP_000547555.1 |
| Coordinates | 1296481..1296792 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5T46_RS06310 | Protein ID | WP_000126294.1 |
| Coordinates | 1296789..1297208 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS06280 (1292416) | 1292416..1294125 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| M5T46_RS06285 (1294135) | 1294135..1294677 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| M5T46_RS06290 (1294677) | 1294677..1295444 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| M5T46_RS06295 (1295441) | 1295441..1295851 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| M5T46_RS06300 (1295844) | 1295844..1296314 | + | 471 | WP_000132967.1 | hydrogenase maturation peptidase HycI | - |
| M5T46_RS06305 (1296481) | 1296481..1296792 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M5T46_RS06310 (1296789) | 1296789..1297208 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M5T46_RS06315 (1297287) | 1297287..1298711 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| M5T46_RS06320 (1298720) | 1298720..1300177 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| M5T46_RS06325 (1300437) | 1300437..1301447 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| M5T46_RS06330 (1301596) | 1301596..1302123 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T255130 WP_000547555.1 NZ_CP103479:1296481-1296792 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT255130 WP_000126294.1 NZ_CP103479:1296789-1297208 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|