Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 18917..19563 Replicon plasmid pMB9698_3
Accession NZ_CP103471
Organism Escherichia coli strain 4973

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M5S50_RS26210 Protein ID WP_000269912.1
Coordinates 18917..19264 (+) Length 116 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M5S50_RS26215 Protein ID WP_001259435.1
Coordinates 19264..19563 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S50_RS26180 (M5S50_26180) 14863..15480 + 618 WP_001523080.1 tail fiber assembly protein -
M5S50_RS26185 (M5S50_26185) 15444..16007 - 564 WP_001523082.1 serine acetyltransferase -
M5S50_RS26190 (M5S50_26190) 16170..16262 - 93 Protein_18 hypothetical protein -
M5S50_RS26195 (M5S50_26195) 16474..17454 + 981 WP_224158527.1 plasmid replication initiator RepA -
M5S50_RS26200 (M5S50_26200) 18098..18385 + 288 WP_000356589.1 hypothetical protein -
M5S50_RS26205 (M5S50_26205) 18409..18672 + 264 WP_000424604.1 hypothetical protein -
M5S50_RS26210 (M5S50_26210) 18917..19264 + 348 WP_000269912.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S50_RS26215 (M5S50_26215) 19264..19563 + 300 WP_001259435.1 XRE family transcriptional regulator Antitoxin
M5S50_RS26220 (M5S50_26220) 19727..20107 + 381 WP_001523084.1 hypothetical protein -
M5S50_RS26225 (M5S50_26225) 20211..20636 - 426 WP_016240784.1 hypothetical protein -
M5S50_RS26230 (M5S50_26230) 20738..20998 + 261 WP_001523087.1 helix-turn-helix domain-containing protein -
M5S50_RS26235 (M5S50_26235) 21621..21809 + 189 WP_004105254.1 hypothetical protein -
M5S50_RS26240 (M5S50_26240) 21820..22446 - 627 WP_244448297.1 Rha family transcriptional regulator -
M5S50_RS26245 (M5S50_26245) 22615..22962 - 348 Protein_29 ORF6N domain-containing protein -
M5S50_RS26250 (M5S50_26250) 22959..23150 - 192 WP_000183351.1 hypothetical protein -
M5S50_RS26255 (M5S50_26255) 23264..23419 - 156 Protein_31 ash family protein -
M5S50_RS26260 (M5S50_26260) 24280..24528 - 249 WP_001523089.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..47715 47715


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13545.51 Da        Isoelectric Point: 8.8337

>T255124 WP_000269912.1 NZ_CP103471:18917-19264 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK

Download         Length: 348 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11046.87 Da        Isoelectric Point: 5.2090

>AT255124 WP_001259435.1 NZ_CP103471:19264-19563 [Escherichia coli]
MRTLDEAIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRIAFNI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References