Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40129..40393 Replicon plasmid pMB9698_2
Accession NZ_CP103470
Organism Escherichia coli strain 4973

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M5S50_RS25870 Protein ID WP_001331364.1
Coordinates 40241..40393 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40129..40186 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S50_RS25855 (36467) 36467..37537 - 1071 WP_000151579.1 IncI1-type conjugal transfer protein TrbB -
M5S50_RS25860 (37556) 37556..38764 - 1209 WP_259423648.1 IncI1-type conjugal transfer protein TrbA -
M5S50_RS25865 (38982) 38982..39935 - 954 WP_021513958.1 hypothetical protein -
- (40129) 40129..40186 - 58 NuclAT_0 - Antitoxin
- (40129) 40129..40186 - 58 NuclAT_0 - Antitoxin
- (40129) 40129..40186 - 58 NuclAT_0 - Antitoxin
- (40129) 40129..40186 - 58 NuclAT_0 - Antitoxin
M5S50_RS25870 (40241) 40241..40393 + 153 WP_001331364.1 Hok/Gef family protein Toxin
M5S50_RS25875 (40821) 40821..41053 + 233 Protein_50 hypothetical protein -
M5S50_RS25880 (41118) 41118..41294 - 177 WP_001054901.1 hypothetical protein -
M5S50_RS25885 (41626) 41626..41835 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
M5S50_RS25890 (41907) 41907..42569 - 663 WP_060527638.1 plasmid IncI1-type surface exclusion protein ExcA -
M5S50_RS25895 (42640) 42640..44808 - 2169 WP_000698368.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..85055 85055


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T255120 WP_001331364.1 NZ_CP103470:40241-40393 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT255120 NZ_CP103470:c40186-40129 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References