Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4946051..4946653 | Replicon | chromosome |
Accession | NZ_CP103468 | ||
Organism | Escherichia coli strain 4973 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5S50_RS23975 | Protein ID | WP_000897305.1 |
Coordinates | 4946342..4946653 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S50_RS23970 | Protein ID | WP_000356397.1 |
Coordinates | 4946051..4946341 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S50_RS23950 (4942553) | 4942553..4943455 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5S50_RS23955 (4943452) | 4943452..4944087 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S50_RS23960 (4944084) | 4944084..4945013 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
M5S50_RS23965 (4945228) | 4945228..4945446 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
M5S50_RS23970 (4946051) | 4946051..4946341 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5S50_RS23975 (4946342) | 4946342..4946653 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5S50_RS23980 (4946882) | 4946882..4947790 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
M5S50_RS23985 (4947854) | 4947854..4948795 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S50_RS23990 (4948840) | 4948840..4949277 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M5S50_RS23995 (4949274) | 4949274..4950146 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5S50_RS24000 (4950140) | 4950140..4950739 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
M5S50_RS24005 (4950838) | 4950838..4951623 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255117 WP_000897305.1 NZ_CP103468:c4946653-4946342 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|