Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4008176..4008870 | Replicon | chromosome |
Accession | NZ_CP103468 | ||
Organism | Escherichia coli strain 4973 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M5S50_RS19455 | Protein ID | WP_001263491.1 |
Coordinates | 4008176..4008574 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | M5S50_RS19460 | Protein ID | WP_000554755.1 |
Coordinates | 4008577..4008870 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S50_RS19425 (4003438) | 4003438..4004895 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
M5S50_RS19430 (4004904) | 4004904..4005185 | + | 282 | WP_022645226.1 | hypothetical protein | - |
M5S50_RS19435 (4005202) | 4005202..4005711 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
M5S50_RS19440 (4005773) | 4005773..4006387 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
M5S50_RS19445 (4006384) | 4006384..4007523 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
M5S50_RS19450 (4007714) | 4007714..4008166 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
M5S50_RS19455 (4008176) | 4008176..4008574 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5S50_RS19460 (4008577) | 4008577..4008870 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5S50_RS19465 (4008922) | 4008922..4009977 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
M5S50_RS19470 (4010048) | 4010048..4010833 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
M5S50_RS19475 (4010805) | 4010805..4012517 | + | 1713 | Protein_3819 | flagellar biosynthesis protein FlhA | - |
M5S50_RS19480 (4012615) | 4012615..4013388 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
M5S50_RS19485 (4013574) | 4013574..4013834 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T255111 WP_001263491.1 NZ_CP103468:c4008574-4008176 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |