Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34575..34828 | Replicon | plasmid pMB9877_1 |
| Accession | NZ_CP103466 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5392 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5T42_RS23355 | Protein ID | WP_001312851.1 |
| Coordinates | 34679..34828 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 34575..34634 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T42_RS23320 (30351) | 30351..31211 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
| M5T42_RS23325 (31314) | 31314..31874 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| M5T42_RS23330 (32003) | 32003..32215 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| M5T42_RS23335 (32460) | 32460..32921 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| M5T42_RS23340 (32967) | 32967..33176 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| M5T42_RS23345 (33214) | 33214..33804 | + | 591 | WP_000766807.1 | DUF2726 domain-containing protein | - |
| M5T42_RS23350 (33959) | 33959..34432 | + | 474 | WP_187810334.1 | hypothetical protein | - |
| - (34575) | 34575..34634 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (34575) | 34575..34634 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (34575) | 34575..34634 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (34575) | 34575..34634 | - | 60 | NuclAT_0 | - | Antitoxin |
| M5T42_RS23355 (34679) | 34679..34828 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5T42_RS23360 (35113) | 35113..35361 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| M5T42_RS23365 (35606) | 35606..35680 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| M5T42_RS23370 (35673) | 35673..36530 | + | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| M5T42_RS23375 (37457) | 37457..38110 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5T42_RS23380 (38203) | 38203..38460 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5T42_RS23385 (38393) | 38393..38794 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5T42_RS23390 (39043) | 39043..39740 | + | 698 | WP_151884388.1 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 | senB | 1..122603 | 122603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255092 WP_001312851.1 NZ_CP103466:34679-34828 [Escherichia coli O25b:H4-ST131]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT255092 NZ_CP103466:c34634-34575 [Escherichia coli O25b:H4-ST131]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
