Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3472776..3473455 | Replicon | chromosome |
| Accession | NZ_CP103465 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5392 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | M5T42_RS16885 | Protein ID | WP_000057523.1 |
| Coordinates | 3473153..3473455 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | M5T42_RS16880 | Protein ID | WP_000806442.1 |
| Coordinates | 3472776..3473117 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T42_RS16870 (3469020) | 3469020..3469952 | - | 933 | WP_000883041.1 | glutaminase A | - |
| M5T42_RS16875 (3470214) | 3470214..3472718 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| M5T42_RS16880 (3472776) | 3472776..3473117 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| M5T42_RS16885 (3473153) | 3473153..3473455 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T42_RS16890 (3473588) | 3473588..3474382 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| M5T42_RS16895 (3474586) | 3474586..3475065 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| M5T42_RS16900 (3475089) | 3475089..3475889 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| M5T42_RS16905 (3475886) | 3475886..3476389 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| M5T42_RS16910 (3476427) | 3476427..3478079 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T255085 WP_000057523.1 NZ_CP103465:c3473455-3473153 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT255085 WP_000806442.1 NZ_CP103465:c3473117-3472776 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|