Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1931373..1931875 | Replicon | chromosome |
Accession | NZ_CP103465 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | S1P977 |
Locus tag | M5T42_RS09150 | Protein ID | WP_000767822.1 |
Coordinates | 1931621..1931875 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | S1Q063 |
Locus tag | M5T42_RS09145 | Protein ID | WP_001259255.1 |
Coordinates | 1931373..1931624 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS09120 (1926551) | 1926551..1927618 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
M5T42_RS09125 (1927618) | 1927618..1928688 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
M5T42_RS09130 (1928685) | 1928685..1929989 | - | 1305 | WP_001546022.1 | histidinol dehydrogenase | - |
M5T42_RS09135 (1929995) | 1929995..1930894 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
M5T42_RS09140 (1931040) | 1931040..1931090 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
M5T42_RS09145 (1931373) | 1931373..1931624 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
M5T42_RS09150 (1931621) | 1931621..1931875 | + | 255 | WP_000767822.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
M5T42_RS09155 (1931958) | 1931958..1932782 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
M5T42_RS09160 (1932828) | 1932828..1933757 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
M5T42_RS09165 (1933972) | 1933972..1934034 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
M5T42_RS09170 (1934024) | 1934024..1935382 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T255077 WP_000767822.1 NZ_CP103465:1931621-1931875 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1P977 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2A6Q | |
AlphaFold DB | A0A7U9LNR0 |