Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 642576..643303 | Replicon | chromosome |
Accession | NZ_CP103465 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M5T42_RS03185 | Protein ID | WP_000550189.1 |
Coordinates | 642576..642890 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5T42_RS03190 | Protein ID | WP_000560269.1 |
Coordinates | 642887..643303 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS03165 (638733) | 638733..639719 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
M5T42_RS03170 (639798) | 639798..640490 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
M5T42_RS03175 (640567) | 640567..641070 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
M5T42_RS03180 (641155) | 641155..642291 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M5T42_RS03185 (642576) | 642576..642890 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M5T42_RS03190 (642887) | 642887..643303 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M5T42_RS03195 (643348) | 643348..645366 | - | 2019 | WP_135097547.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M5T42_RS03200 (645592) | 645592..647943 | - | 2352 | WP_000695431.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T255073 WP_000550189.1 NZ_CP103465:642576-642890 [Escherichia coli O25b:H4-ST131]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT255073 WP_000560269.1 NZ_CP103465:642887-643303 [Escherichia coli O25b:H4-ST131]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|