Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 184977..186295 | Replicon | chromosome |
Accession | NZ_CP103465 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | M5T42_RS00880 | Protein ID | WP_001262467.1 |
Coordinates | 185288..186295 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | M5T42_RS00875 | Protein ID | WP_001312177.1 |
Coordinates | 184977..185288 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS00845 (180264) | 180264..180491 | - | 228 | WP_000198577.1 | hypothetical protein | - |
M5T42_RS00850 (180509) | 180509..181528 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
M5T42_RS00855 (181538) | 181538..182440 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
M5T42_RS00860 (182451) | 182451..183434 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
M5T42_RS00865 (183431) | 183431..184444 | + | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
M5T42_RS00870 (184669) | 184669..184992 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
M5T42_RS00875 (184977) | 184977..185288 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
M5T42_RS00880 (185288) | 185288..186295 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
M5T42_RS00885 (186312) | 186312..187583 | - | 1272 | WP_001545666.1 | amino acid permease | - |
- (187945) | 187945..188010 | - | 66 | NuclAT_27 | - | - |
- (187945) | 187945..188010 | - | 66 | NuclAT_27 | - | - |
- (187945) | 187945..188010 | - | 66 | NuclAT_27 | - | - |
- (187945) | 187945..188010 | - | 66 | NuclAT_27 | - | - |
M5T42_RS00890 (188059) | 188059..188166 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (188428) | 188428..188485 | - | 58 | NuclAT_26 | - | - |
- (188428) | 188428..188485 | - | 58 | NuclAT_26 | - | - |
- (188428) | 188428..188485 | - | 58 | NuclAT_26 | - | - |
- (188428) | 188428..188485 | - | 58 | NuclAT_26 | - | - |
M5T42_RS00895 (188542) | 188542..188649 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
M5T42_RS00900 (189025) | 189025..189132 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
M5T42_RS00905 (189218) | 189218..190897 | - | 1680 | Protein_178 | cellulose biosynthesis protein BcsG | - |
M5T42_RS00910 (190894) | 190894..191085 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T255070 WP_001262467.1 NZ_CP103465:185288-186295 [Escherichia coli O25b:H4-ST131]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |