Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 857635..858245 Replicon chromosome
Accession NZ_CP103450
Organism Erwinia pyrifoliae strain CP201179

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NYP81_RS04240 Protein ID WP_259818088.1
Coordinates 857934..858245 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NYP81_RS04235 Protein ID WP_259818087.1
Coordinates 857635..857931 (-) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP81_RS04205 (NYP81_04205) 853778..853933 - 156 WP_168400670.1 GpE family phage tail protein -
NYP81_RS04210 (NYP81_04210) 853939..854256 - 318 WP_259818083.1 phage tail assembly protein -
NYP81_RS04215 (NYP81_04215) 854304..854819 - 516 WP_259819524.1 phage major tail tube protein -
NYP81_RS04220 (NYP81_04220) 854820..856001 - 1182 WP_259818085.1 phage tail sheath family protein -
NYP81_RS04225 (NYP81_04225) 856153..857289 + 1137 WP_259819525.1 phage late control D family protein -
NYP81_RS04230 (NYP81_04230) 857329..857577 + 249 WP_012668492.1 ogr/Delta-like zinc finger family protein -
NYP81_RS04235 (NYP81_04235) 857635..857931 - 297 WP_259818087.1 NadS family protein Antitoxin
NYP81_RS04240 (NYP81_04240) 857934..858245 - 312 WP_259818088.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NYP81_RS04245 (NYP81_04245) 858657..858905 - 249 WP_012668492.1 ogr/Delta-like zinc finger family protein -
NYP81_RS04250 (NYP81_04250) 858945..859261 - 317 Protein_800 contractile injection system protein, VgrG/Pvc8 family -
NYP81_RS04255 (NYP81_04255) 859560..860468 + 909 WP_012668491.1 hypothetical protein -
NYP81_RS04260 (NYP81_04260) 860572..860824 + 253 Protein_802 IS110 family transposase -
NYP81_RS04265 (NYP81_04265) 861539..862690 + 1152 WP_259819527.1 hypothetical protein -
NYP81_RS04270 (NYP81_04270) 862794..863046 + 253 Protein_804 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 825766..864914 39148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(43-100)

Antitoxin

Cro/C1-type helix-turn-helix domain

(36-87)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12033.69 Da        Isoelectric Point: 7.0154

>T255060 WP_259818088.1 NZ_CP103450:c858245-857934 [Erwinia pyrifoliae]
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW

Download         Length: 312 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 10915.51 Da        Isoelectric Point: 10.5573

>AT255060 WP_259818087.1 NZ_CP103450:c857931-857635 [Erwinia pyrifoliae]
MEKKLFERLKESMTQMNEINEGSRDPSRETNVIAVQVKAIRTASGLSQSGFAKLISVNLDTLKNWEQGRREPTGPAKALL
RAIERDPQHVIPALSAKS

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References