Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4074454..4075051 | Replicon | chromosome |
Accession | NZ_CP103419 | ||
Organism | Klebsiella variicola strain KV4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B7GEF2 |
Locus tag | NYO13_RS19690 | Protein ID | WP_012542526.1 |
Coordinates | 4074734..4075051 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYO13_RS19685 | Protein ID | WP_012542525.1 |
Coordinates | 4074454..4074741 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO13_RS19655 (NYO13_19655) | 4070276..4070524 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
NYO13_RS19660 (NYO13_19660) | 4070541..4070882 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
NYO13_RS19665 (NYO13_19665) | 4070913..4072028 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
NYO13_RS19670 (NYO13_19670) | 4072208..4072789 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
NYO13_RS19675 (NYO13_19675) | 4072789..4073157 | + | 369 | WP_259144806.1 | MmcQ/YjbR family DNA-binding protein | - |
NYO13_RS19680 (NYO13_19680) | 4073277..4073930 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NYO13_RS19685 (NYO13_19685) | 4074454..4074741 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYO13_RS19690 (NYO13_19690) | 4074734..4075051 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYO13_RS19695 (NYO13_19695) | 4075236..4076279 | - | 1044 | WP_048330781.1 | DUF2157 domain-containing protein | - |
NYO13_RS19700 (NYO13_19700) | 4076942..4077808 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
NYO13_RS19705 (NYO13_19705) | 4077917..4079344 | + | 1428 | WP_048330780.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T255024 WP_012542526.1 NZ_CP103419:c4075051-4074734 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|