Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1794919..1795579 | Replicon | chromosome |
Accession | NZ_CP103419 | ||
Organism | Klebsiella variicola strain KV4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B6IX92 |
Locus tag | NYO13_RS08615 | Protein ID | WP_008804168.1 |
Coordinates | 1795226..1795579 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYO13_RS08610 | Protein ID | WP_032700907.1 |
Coordinates | 1794919..1795221 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO13_RS08575 (NYO13_08575) | 1790264..1791364 | - | 1101 | WP_048330526.1 | AarF/UbiB family protein | - |
NYO13_RS08580 (NYO13_08580) | 1791891..1792148 | + | 258 | WP_012541132.1 | antitoxin | - |
NYO13_RS08585 (NYO13_08585) | 1792149..1792481 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
NYO13_RS08595 (NYO13_08595) | 1792804..1794240 | + | 1437 | WP_259145131.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NYO13_RS08605 (NYO13_08605) | 1794566..1794715 | - | 150 | Protein_1683 | antitoxin | - |
NYO13_RS08610 (NYO13_08610) | 1794919..1795221 | - | 303 | WP_032700907.1 | XRE family transcriptional regulator | Antitoxin |
NYO13_RS08615 (NYO13_08615) | 1795226..1795579 | - | 354 | WP_008804168.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYO13_RS08620 (NYO13_08620) | 1795783..1797264 | + | 1482 | WP_008804169.1 | hypothetical protein | - |
NYO13_RS08625 (NYO13_08625) | 1797353..1798807 | - | 1455 | WP_008804170.1 | AMP nucleosidase | - |
NYO13_RS08630 (NYO13_08630) | 1798938..1799183 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13528.51 Da Isoelectric Point: 10.1729
>T255018 WP_008804168.1 NZ_CP103419:c1795579-1795226 [Klebsiella variicola]
VWTIKTTDMFDRWFTSLNDIDRASVLAALLVLREKGPGLSRPYADTIRGSRYSNMKELRVQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYHEMLAVADREFTNWLNRLKEKE
VWTIKTTDMFDRWFTSLNDIDRASVLAALLVLREKGPGLSRPYADTIRGSRYSNMKELRVQSRGDPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYHEMLAVADREFTNWLNRLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|