Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 343298..343944 | Replicon | chromosome |
Accession | NZ_CP103419 | ||
Organism | Klebsiella variicola strain KV4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1F2M0N0 |
Locus tag | NYO13_RS01560 | Protein ID | WP_008806991.1 |
Coordinates | 343298..343645 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1F2LZT5 |
Locus tag | NYO13_RS01565 | Protein ID | WP_008806992.1 |
Coordinates | 343645..343944 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO13_RS01550 (NYO13_01550) | 339185..340618 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
NYO13_RS01555 (NYO13_01555) | 340636..343083 | + | 2448 | WP_008806990.1 | glycogen phosphorylase | - |
NYO13_RS01560 (NYO13_01560) | 343298..343645 | + | 348 | WP_008806991.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYO13_RS01565 (NYO13_01565) | 343645..343944 | + | 300 | WP_008806992.1 | XRE family transcriptional regulator | Antitoxin |
NYO13_RS01570 (NYO13_01570) | 344007..345515 | - | 1509 | WP_008806993.1 | glycerol-3-phosphate dehydrogenase | - |
NYO13_RS01575 (NYO13_01575) | 345720..346049 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
NYO13_RS01580 (NYO13_01580) | 346100..346930 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
NYO13_RS01585 (NYO13_01585) | 346980..347738 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13504.52 Da Isoelectric Point: 6.2327
>T255014 WP_008806991.1 NZ_CP103419:343298-343645 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M0N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZT5 |