Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4237..4888 | Replicon | plasmid pAB2369-2 |
| Accession | NZ_CP103415 | ||
| Organism | Acinetobacter baumannii strain AB2369 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8YFZ1 |
| Locus tag | NX832_RS19020 | Protein ID | WP_000269904.1 |
| Coordinates | 4237..4593 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NX832_RS19025 | Protein ID | WP_001129974.1 |
| Coordinates | 4586..4888 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NX832_RS19000 (NX832_19000) | 427..1218 | + | 792 | WP_259024969.1 | hypothetical protein | - |
| NX832_RS19005 (NX832_19005) | 1631..2566 | + | 936 | WP_001292329.1 | replication initiation protein RepM | - |
| NX832_RS19010 (NX832_19010) | 2644..3162 | + | 519 | WP_000839337.1 | plasmid replication DNA-binding protein | - |
| NX832_RS19015 (NX832_19015) | 3372..3671 | + | 300 | WP_000358348.1 | hypothetical protein | - |
| NX832_RS19020 (NX832_19020) | 4237..4593 | + | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NX832_RS19025 (NX832_19025) | 4586..4888 | + | 303 | WP_001129974.1 | XRE family transcriptional regulator | Antitoxin |
| NX832_RS19030 (NX832_19030) | 4881..5090 | + | 210 | WP_000069474.1 | hypothetical protein | - |
| NX832_RS19035 (NX832_19035) | 5416..5877 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| NX832_RS19040 (NX832_19040) | 6182..8593 | - | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
| NX832_RS19045 (NX832_19045) | 8721..9035 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
| NX832_RS19050 (NX832_19050) | 9022..9309 | - | 288 | WP_000438827.1 | BrnT family toxin | - |
| NX832_RS19055 (NX832_19055) | 9577..9876 | - | 300 | WP_000358348.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..11192 | 11192 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T255011 WP_000269904.1 NZ_CP103415:4237-4593 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|