Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4586..5237 | Replicon | plasmid pAB2369-1 |
Accession | NZ_CP103414 | ||
Organism | Acinetobacter baumannii strain AB2369 |
Toxin (Protein)
Gene name | higB | Uniprot ID | N8YFZ1 |
Locus tag | NX832_RS18960 | Protein ID | WP_000269904.1 |
Coordinates | 4881..5237 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NX832_RS18955 | Protein ID | WP_001129974.1 |
Coordinates | 4586..4888 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX832_RS18930 (NX832_18930) | 166..452 | + | 287 | Protein_0 | BrnT family toxin | - |
NX832_RS18935 (NX832_18935) | 439..753 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
NX832_RS18940 (NX832_18940) | 881..3292 | + | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
NX832_RS18945 (NX832_18945) | 3597..4058 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
NX832_RS18950 (NX832_18950) | 4384..4593 | - | 210 | WP_000069474.1 | hypothetical protein | - |
NX832_RS18955 (NX832_18955) | 4586..4888 | - | 303 | WP_001129974.1 | XRE family transcriptional regulator | Antitoxin |
NX832_RS18960 (NX832_18960) | 4881..5237 | - | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NX832_RS18965 (NX832_18965) | 5803..6102 | - | 300 | WP_000358348.1 | hypothetical protein | - |
NX832_RS18970 (NX832_18970) | 6219..6980 | - | 762 | WP_000425105.1 | hypothetical protein | - |
NX832_RS18975 (NX832_18975) | 7285..8454 | + | 1170 | WP_002134206.1 | MobA/MobL family protein | - |
NX832_RS18980 (NX832_18980) | 9051..9986 | + | 936 | WP_001292329.1 | replication initiation protein RepM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11193 | 11193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T255010 WP_000269904.1 NZ_CP103414:c5237-4881 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|