Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 327205..328026 | Replicon | plasmid unnamed1 |
Accession | NZ_CP103402 | ||
Organism | Pantoea agglomerans strain CHTF15 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NYF24_RS20230 | Protein ID | WP_256849619.1 |
Coordinates | 327205..327675 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NYF24_RS20235 | Protein ID | WP_132498989.1 |
Coordinates | 327682..328026 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF24_RS20220 (NYF24_20220) | 322529..324931 | + | 2403 | WP_258995947.1 | maltodextrin phosphorylase | - |
NYF24_RS20225 (NYF24_20225) | 324940..327015 | + | 2076 | WP_258995948.1 | 4-alpha-glucanotransferase | - |
NYF24_RS20230 (NYF24_20230) | 327205..327675 | - | 471 | WP_256849619.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
NYF24_RS20235 (NYF24_20235) | 327682..328026 | - | 345 | WP_132498989.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NYF24_RS20240 (NYF24_20240) | 328126..328341 | - | 216 | WP_033780170.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NYF24_RS20245 (NYF24_20245) | 328530..329468 | - | 939 | WP_010247352.1 | maltose operon protein MalM | - |
NYF24_RS20250 (NYF24_20250) | 329571..330872 | - | 1302 | WP_033760237.1 | maltoporin | - |
NYF24_RS20255 (NYF24_20255) | 330916..332025 | - | 1110 | WP_010247360.1 | maltose/maltodextrin ABC transporter ATP-binding protein MalK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..514938 | 514938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 18195.73 Da Isoelectric Point: 8.6601
>T255003 WP_256849619.1 NZ_CP103402:c327675-327205 [Pantoea agglomerans]
MEDSTVINGRHVYVHPCFESQLIALTNEVELLRAKYPESYQRKATTKLLAAVFKVINSEICADPHQAKFRQGDTLGEQNK
HWFRAKFLMQYRLFFRFSEQHKTIILAWMNDAETKCAYGSKRDAYKVFSGMLHNGYPPDDWALLLKQSQDWANTNS
MEDSTVINGRHVYVHPCFESQLIALTNEVELLRAKYPESYQRKATTKLLAAVFKVINSEICADPHQAKFRQGDTLGEQNK
HWFRAKFLMQYRLFFRFSEQHKTIILAWMNDAETKCAYGSKRDAYKVFSGMLHNGYPPDDWALLLKQSQDWANTNS
Download Length: 471 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|