Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3709328..3709980 | Replicon | chromosome |
Accession | NZ_CP103401 | ||
Organism | Pantoea agglomerans strain CHTF15 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8X8DRT2 |
Locus tag | NYF24_RS17410 | Protein ID | WP_010672045.1 |
Coordinates | 3709328..3709681 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8X8DRN0 |
Locus tag | NYF24_RS17415 | Protein ID | WP_010252120.1 |
Coordinates | 3709681..3709980 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF24_RS17395 (3705054) | 3705054..3706838 | - | 1785 | WP_060681540.1 | GMC family oxidoreductase | - |
NYF24_RS17400 (3706841) | 3706841..3707575 | - | 735 | WP_010672043.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
NYF24_RS17405 (3707852) | 3707852..3709093 | + | 1242 | WP_010672044.1 | peptide antibiotic transporter SbmA | - |
NYF24_RS17410 (3709328) | 3709328..3709681 | + | 354 | WP_010672045.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYF24_RS17415 (3709681) | 3709681..3709980 | + | 300 | WP_010252120.1 | XRE family transcriptional regulator | Antitoxin |
NYF24_RS17420 (3710102) | 3710102..3711154 | - | 1053 | WP_061901847.1 | YncE family protein | - |
NYF24_RS17425 (3711357) | 3711357..3711566 | - | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
NYF24_RS17430 (3711779) | 3711779..3712966 | - | 1188 | WP_258993052.1 | MFS transporter | - |
NYF24_RS17435 (3713071) | 3713071..3714036 | + | 966 | WP_033770846.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13660.67 Da Isoelectric Point: 7.9792
>T255002 WP_010672045.1 NZ_CP103401:3709328-3709681 [Pantoea agglomerans]
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYRNMKELRVQFSGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYRNMKELRVQFSGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|