Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 3486039..3486439 | Replicon | chromosome |
| Accession | NZ_CP103401 | ||
| Organism | Pantoea agglomerans strain CHTF15 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | NYF24_RS16420 | Protein ID | WP_258992899.1 |
| Coordinates | 3486039..3486368 (-) | Length | 110 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3486363..3486439 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYF24_RS16390 (3481466) | 3481466..3482284 | - | 819 | WP_258992893.1 | CDP-diacylglycerol diphosphatase | - |
| NYF24_RS16395 (3482358) | 3482358..3482492 | - | 135 | WP_158149584.1 | hypothetical protein | - |
| NYF24_RS16400 (3482909) | 3482909..3483601 | + | 693 | WP_033769578.1 | LuxR family transcriptional regulator | - |
| NYF24_RS16405 (3483616) | 3483616..3484254 | - | 639 | WP_031593697.1 | acyl-homoserine-lactone synthase | - |
| NYF24_RS16410 (3485544) | 3485544..3485807 | - | 264 | WP_256849118.1 | hypothetical protein | - |
| NYF24_RS16415 (3485776) | 3485776..3485997 | - | 222 | WP_258995815.1 | DUF2778 domain-containing protein | - |
| NYF24_RS16420 (3486039) | 3486039..3486368 | - | 330 | WP_258992899.1 | endoribonuclease SymE | Toxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_0 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_0 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_0 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_0 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_1 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_1 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_1 | - | Antitoxin |
| - (3486363) | 3486363..3486439 | + | 77 | NuclAT_1 | - | Antitoxin |
| NYF24_RS16425 (3486892) | 3486892..3487215 | - | 324 | WP_039386786.1 | DNA-binding transcriptional regulator | - |
| NYF24_RS16430 (3487199) | 3487199..3487441 | - | 243 | Protein_3200 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NYF24_RS16435 (3487645) | 3487645..3488697 | + | 1053 | WP_258992903.1 | hypothetical protein | - |
| NYF24_RS16440 (3488691) | 3488691..3488966 | + | 276 | WP_033759756.1 | hypothetical protein | - |
| NYF24_RS16445 (3489151) | 3489151..3489384 | + | 234 | WP_258995816.1 | MarR family transcriptional regulator | - |
| NYF24_RS16450 (3489470) | 3489470..3490439 | - | 970 | Protein_3204 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3482909..3507443 | 24534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12052.83 Da Isoelectric Point: 8.4951
>T254998 WP_258992899.1 NZ_CP103401:c3486368-3486039 [Pantoea agglomerans]
MTDAHSIAQPSEPEVSPADNRQLTVSYASRYPDYSRIPAITMKGQWLEAAGFATGTAVDVKVMEGCIVLTARQESELIQS
LRQVCKLSARKQQQVQEFIKVITGKQKVV
MTDAHSIAQPSEPEVSPADNRQLTVSYASRYPDYSRIPAITMKGQWLEAAGFATGTAVDVKVMEGCIVLTARQESELIQS
LRQVCKLSARKQQQVQEFIKVITGKQKVV
Download Length: 330 bp
Antitoxin
Download Length: 77 bp
>AT254998 NZ_CP103401:3486363-3486439 [Pantoea agglomerans]
AGTCATGATTACTATTCTCCGTAAATAGTAGTTGTGATTAGCGGCGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCGTAAATAGTAGTTGTGATTAGCGGCGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
