Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2786368..2786972 | Replicon | chromosome |
Accession | NZ_CP103401 | ||
Organism | Pantoea agglomerans strain CHTF15 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYF24_RS13050 | Protein ID | WP_010669712.1 |
Coordinates | 2786368..2786679 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYF24_RS13055 | Protein ID | WP_010669711.1 |
Coordinates | 2786679..2786972 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF24_RS13030 (2781378) | 2781378..2782325 | - | 948 | WP_010254263.1 | ABC transporter ATP-binding protein | - |
NYF24_RS13035 (2782318) | 2782318..2783493 | - | 1176 | WP_187505321.1 | ABC transporter permease | - |
NYF24_RS13040 (2783497) | 2783497..2784408 | - | 912 | WP_022625994.1 | ABC transporter substrate-binding protein | - |
NYF24_RS13045 (2784715) | 2784715..2786190 | + | 1476 | WP_033785500.1 | MFS transporter | - |
NYF24_RS13050 (2786368) | 2786368..2786679 | + | 312 | WP_010669712.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYF24_RS13055 (2786679) | 2786679..2786972 | + | 294 | WP_010669711.1 | NadS family protein | Antitoxin |
NYF24_RS13060 (2787109) | 2787109..2787651 | - | 543 | WP_050679469.1 | isopentenyl-diphosphate Delta-isomerase | - |
NYF24_RS13065 (2787798) | 2787798..2789693 | - | 1896 | WP_022625996.1 | methyl-accepting chemotaxis protein | - |
NYF24_RS13070 (2789885) | 2789885..2790994 | - | 1110 | WP_022625997.1 | suppressor of fused domain protein | - |
NYF24_RS13075 (2791325) | 2791325..2791552 | - | 228 | WP_157351749.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11997.67 Da Isoelectric Point: 5.8988
>T254995 WP_010669712.1 NZ_CP103401:2786368-2786679 [Pantoea agglomerans]
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPGWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSESQIRLLLIY
KKGVQDDLSEDEKHLLRALNEGW
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPGWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSESQIRLLLIY
KKGVQDDLSEDEKHLLRALNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|