Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1523521..1524181 | Replicon | chromosome |
Accession | NZ_CP103401 | ||
Organism | Pantoea agglomerans strain CHTF15 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A349IFT5 |
Locus tag | NYF24_RS06965 | Protein ID | WP_010670918.1 |
Coordinates | 1523521..1523874 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYF24_RS06970 | Protein ID | WP_010247918.1 |
Coordinates | 1523879..1524181 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF24_RS06945 (1518718) | 1518718..1518999 | + | 282 | WP_187492155.1 | hypothetical protein | - |
NYF24_RS06950 (1519098) | 1519098..1519499 | + | 402 | WP_010247930.1 | cell envelope integrity TolA C-terminal domain-containing protein | - |
NYF24_RS06955 (1519576) | 1519576..1521738 | - | 2163 | WP_258995149.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
NYF24_RS06960 (1522134) | 1522134..1523222 | + | 1089 | WP_258995151.1 | YncE family protein | - |
NYF24_RS06965 (1523521) | 1523521..1523874 | + | 354 | WP_010670918.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYF24_RS06970 (1523879) | 1523879..1524181 | + | 303 | WP_010247918.1 | XRE family transcriptional regulator | Antitoxin |
NYF24_RS06980 (1524853) | 1524853..1525776 | + | 924 | WP_010247907.1 | sugar ABC transporter substrate-binding protein | - |
NYF24_RS06985 (1525809) | 1525809..1527293 | + | 1485 | WP_010247905.1 | sugar ABC transporter ATP-binding protein | - |
NYF24_RS06990 (1527317) | 1527317..1528342 | + | 1026 | WP_174819610.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13649.71 Da Isoelectric Point: 8.4949
>T254993 WP_010670918.1 NZ_CP103401:1523521-1523874 [Pantoea agglomerans]
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|