Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 1898999..1899213 | Replicon | chromosome |
Accession | NZ_CP103350 | ||
Organism | Bacillus subtilis strain SRCM117108 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | NX810_RS09565 | Protein ID | WP_017696861.1 |
Coordinates | 1898999..1899175 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 1899116..1899213 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX810_RS09550 | 1894777..1895679 | - | 903 | WP_061891092.1 | GIY-YIG nuclease family protein | - |
NX810_RS09555 | 1895864..1897738 | - | 1875 | Protein_1826 | hypothetical protein | - |
NX810_RS09560 | 1897778..1897972 | - | 195 | WP_068947523.1 | hypothetical protein | - |
- | 1898958..1899058 | - | 101 | NuclAT_0 | - | - |
- | 1898958..1899058 | - | 101 | NuclAT_0 | - | - |
- | 1898958..1899058 | - | 101 | NuclAT_0 | - | - |
- | 1898958..1899058 | - | 101 | NuclAT_0 | - | - |
NX810_RS09565 | 1898999..1899175 | + | 177 | WP_017696861.1 | hypothetical protein | Toxin |
- | 1899116..1899213 | - | 98 | - | - | Antitoxin |
NX810_RS09570 | 1899194..1899444 | + | 251 | Protein_1829 | hypothetical protein | - |
NX810_RS09575 | 1899489..1899677 | + | 189 | WP_003230987.1 | hypothetical protein | - |
NX810_RS09580 | 1899759..1900976 | + | 1218 | WP_068947524.1 | hypothetical protein | - |
NX810_RS09585 | 1901292..1902146 | + | 855 | WP_068947525.1 | hypothetical protein | - |
NX810_RS09590 | 1902152..1903078 | + | 927 | WP_068947526.1 | hypothetical protein | - |
NX810_RS09595 | 1903080..1903682 | + | 603 | WP_021493585.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1837138..1997422 | 160284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T254981 WP_017696861.1 NZ_CP103350:1898999-1899175 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 98 bp
>AT254981 NZ_CP103350:c1899213-1899116 [Bacillus subtilis]
GAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAGCCG
CTTGCGTATACGCTTTTT
GAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAGCCG
CTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|