Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 18068..18719 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP103340 | ||
| Organism | Acinetobacter baumannii strain AB105 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3R9RP36 |
| Locus tag | NT399_RS18085 | Protein ID | WP_068520067.1 |
| Coordinates | 18363..18719 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NT399_RS18080 | Protein ID | WP_001140620.1 |
| Coordinates | 18068..18370 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT399_RS18060 (NT399_18060) | 13424..13813 | - | 390 | WP_004781111.1 | tautomerase family protein | - |
| NT399_RS18065 (NT399_18065) | 14011..15687 | - | 1677 | WP_024437862.1 | AlwI family type II restriction endonuclease | - |
| NT399_RS18070 (NT399_18070) | 15735..17657 | - | 1923 | WP_024437863.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
| NT399_RS18075 (NT399_18075) | 17650..17901 | - | 252 | WP_114889766.1 | XRE family transcriptional regulator | - |
| NT399_RS18080 (NT399_18080) | 18068..18370 | - | 303 | WP_001140620.1 | XRE family transcriptional regulator | Antitoxin |
| NT399_RS18085 (NT399_18085) | 18363..18719 | - | 357 | WP_068520067.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NT399_RS18090 (NT399_18090) | 19455..21509 | + | 2055 | WP_004740259.1 | TonB-dependent receptor | - |
| NT399_RS18095 (NT399_18095) | 21623..22309 | + | 687 | WP_004740261.1 | DUF4145 domain-containing protein | - |
| NT399_RS18100 (NT399_18100) | 22351..22458 | + | 108 | Protein_25 | transcriptional regulator | - |
| NT399_RS18105 (NT399_18105) | 22656..22991 | + | 336 | WP_004740263.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..50018 | 50018 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13572.58 Da Isoelectric Point: 7.1650
>T254964 WP_068520067.1 NZ_CP103340:c18719-18363 [Acinetobacter baumannii]
MWTVITTDLFNQWLEQQEESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIADKGGKKRFYKDMLDIADEQYQLHLTTLGDKSNG
MWTVITTDLFNQWLEQQEESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIADKGGKKRFYKDMLDIADEQYQLHLTTLGDKSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|