Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1835465..1836116 | Replicon | chromosome |
| Accession | NZ_CP103338 | ||
| Organism | Acinetobacter baumannii strain AB105 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S3SZA7 |
| Locus tag | NT399_RS08810 | Protein ID | WP_000269903.1 |
| Coordinates | 1835760..1836116 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NT399_RS08805 | Protein ID | WP_001140619.1 |
| Coordinates | 1835465..1835767 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT399_RS08775 (NT399_08775) | 1830550..1830901 | - | 352 | Protein_1709 | transposase | - |
| NT399_RS08780 (NT399_08780) | 1831044..1831292 | + | 249 | WP_002084120.1 | diguanylate cyclase | - |
| NT399_RS08785 (NT399_08785) | 1831304..1831792 | + | 489 | WP_038342305.1 | phosphate-starvation-inducible PsiE family protein | - |
| NT399_RS08790 (NT399_08790) | 1831779..1832589 | + | 811 | Protein_1712 | zinc metalloprotease HtpX | - |
| NT399_RS08795 (NT399_08795) | 1832609..1833760 | + | 1152 | WP_188198428.1 | trypsin-like peptidase domain-containing protein | - |
| NT399_RS08800 (NT399_08800) | 1834342..1835274 | - | 933 | WP_049590625.1 | IS5-like element ISAba13 family transposase | - |
| NT399_RS08805 (NT399_08805) | 1835465..1835767 | - | 303 | WP_001140619.1 | XRE family transcriptional regulator | Antitoxin |
| NT399_RS08810 (NT399_08810) | 1835760..1836116 | - | 357 | WP_000269903.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NT399_RS08815 (NT399_08815) | 1836666..1837991 | - | 1326 | Protein_1717 | ISNCY family transposase | - |
| NT399_RS08820 (NT399_08820) | 1838548..1840809 | + | 2262 | WP_000167003.1 | excinuclease ABC subunit UvrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1804735..1837667 | 32932 | |
| - | inside | IScluster/Tn | - | - | 1834342..1837667 | 3325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13486.45 Da Isoelectric Point: 7.1645
>T254962 WP_000269903.1 NZ_CP103338:c1836116-1835760 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|