Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 13000..13253 Replicon plasmid p4
Accession NZ_CP103333
Organism Escherichia coli strain ZY22049

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NX000_RS26150 Protein ID WP_001312851.1
Coordinates 13104..13253 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 13000..13059 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NX000_RS26110 (8957) 8957..9250 + 294 WP_032146011.1 hypothetical protein -
NX000_RS26115 (9327) 9327..10010 + 684 WP_000085883.1 DNA methylase -
NX000_RS26120 (10011) 10011..10232 + 222 WP_001104881.1 hypothetical protein -
NX000_RS26125 (10246) 10246..10680 + 435 WP_000274503.1 DUF1380 family protein -
NX000_RS26130 (10726) 10726..11088 + 363 Protein_16 fertility inhibition protein FinO -
NX000_RS26135 (11220) 11220..11420 + 201 WP_015059022.1 hypothetical protein -
NX000_RS26140 (11806) 11806..12405 + 600 WP_105906770.1 PIN domain-containing protein -
NX000_RS26145 (12467) 12467..12799 + 333 WP_152916585.1 hypothetical protein -
- (13000) 13000..13059 - 60 NuclAT_0 - Antitoxin
- (13000) 13000..13059 - 60 NuclAT_0 - Antitoxin
- (13000) 13000..13059 - 60 NuclAT_0 - Antitoxin
- (13000) 13000..13059 - 60 NuclAT_0 - Antitoxin
NX000_RS26150 (13104) 13104..13253 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NX000_RS26155 (13537) 13537..13785 + 249 WP_000083837.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..14096 14096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T254961 WP_001312851.1 NZ_CP103333:13104-13253 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT254961 NZ_CP103333:c13059-13000 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References