Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13000..13253 | Replicon | plasmid p4 |
| Accession | NZ_CP103333 | ||
| Organism | Escherichia coli strain ZY22049 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NX000_RS26150 | Protein ID | WP_001312851.1 |
| Coordinates | 13104..13253 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 13000..13059 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NX000_RS26110 (8957) | 8957..9250 | + | 294 | WP_032146011.1 | hypothetical protein | - |
| NX000_RS26115 (9327) | 9327..10010 | + | 684 | WP_000085883.1 | DNA methylase | - |
| NX000_RS26120 (10011) | 10011..10232 | + | 222 | WP_001104881.1 | hypothetical protein | - |
| NX000_RS26125 (10246) | 10246..10680 | + | 435 | WP_000274503.1 | DUF1380 family protein | - |
| NX000_RS26130 (10726) | 10726..11088 | + | 363 | Protein_16 | fertility inhibition protein FinO | - |
| NX000_RS26135 (11220) | 11220..11420 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NX000_RS26140 (11806) | 11806..12405 | + | 600 | WP_105906770.1 | PIN domain-containing protein | - |
| NX000_RS26145 (12467) | 12467..12799 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (13000) | 13000..13059 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (13000) | 13000..13059 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (13000) | 13000..13059 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (13000) | 13000..13059 | - | 60 | NuclAT_0 | - | Antitoxin |
| NX000_RS26150 (13104) | 13104..13253 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NX000_RS26155 (13537) | 13537..13785 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..14096 | 14096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254961 WP_001312851.1 NZ_CP103333:13104-13253 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT254961 NZ_CP103333:c13059-13000 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|