Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40768..41032 Replicon plasmid p3
Accession NZ_CP103332
Organism Escherichia coli strain ZY22049

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NX000_RS25815 Protein ID WP_001331364.1
Coordinates 40880..41032 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40768..40825 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NX000_RS25795 (35770) 35770..36840 - 1071 WP_065523389.1 IncI1-type conjugal transfer protein TrbB -
NX000_RS25800 (36859) 36859..38067 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
NX000_RS25805 (38285) 38285..39238 - 954 WP_021513958.1 hypothetical protein -
NX000_RS25810 (39492) 39492..40720 + 1229 WP_102384962.1 IS3 family transposase -
- (40768) 40768..40825 - 58 NuclAT_0 - Antitoxin
- (40768) 40768..40825 - 58 NuclAT_0 - Antitoxin
- (40768) 40768..40825 - 58 NuclAT_0 - Antitoxin
- (40768) 40768..40825 - 58 NuclAT_0 - Antitoxin
NX000_RS25815 (40880) 40880..41032 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NX000_RS25820 (41104) 41104..41355 - 252 WP_001291964.1 hypothetical protein -
NX000_RS25825 (41854) 41854..41949 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
NX000_RS25830 (42014) 42014..42190 - 177 WP_001054900.1 hypothetical protein -
NX000_RS25835 (42522) 42522..42731 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
NX000_RS25840 (42803) 42803..43465 - 663 WP_000644792.1 plasmid IncI1-type surface exclusion protein ExcA -
NX000_RS25845 (43530) 43530..45698 - 2169 WP_000698366.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..85443 85443


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T254957 WP_001331364.1 NZ_CP103332:40880-41032 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT254957 NZ_CP103332:c40825-40768 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References