Detailed information of TA system TA254953

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 90952..91378
• Replicon: plasmid p2
• Accession: NZ_CP103331
• Organism: Escherichia coli strain ZY22049

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NX000_RS25400
• Protein ID: WP_001372321.1
• Coordinates: 90952..91077 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	91154..91378 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NX000_RS25360 (86326)	86326..87015	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NX000_RS25365 (87202)	87202..87585	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NX000_RS25370 (87906)	87906..88508	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NX000_RS25375 (88805)	88805..89626	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NX000_RS25380 (89744)	89744..90031	-	288	WP_000107535.1	hypothetical protein	-
NX000_RS25385 (90056)	90056..90262	-	207	WP_000547968.1	hypothetical protein	-
NX000_RS25390 (90332)	90332..90504	+	173	Protein_102	hypothetical protein	-
NX000_RS25395 (90502)	90502..90732	-	231	WP_071586998.1	hypothetical protein	-
NX000_RS25400 (90952)	90952..91077	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NX000_RS25405 (91019)	91019..91168	-	150	Protein_105	plasmid maintenance protein Mok	-
- (91154)	91154..91378	-	225	NuclAT_0	-	Antitoxin
- (91154)	91154..91378	-	225	NuclAT_0	-	Antitoxin
- (91154)	91154..91378	-	225	NuclAT_0	-	Antitoxin
- (91154)	91154..91378	-	225	NuclAT_0	-	Antitoxin
NX000_RS25410 (91190)	91190..91378	+	189	WP_001299721.1	hypothetical protein	-
NX000_RS25415 (91347)	91347..92109	-	763	Protein_107	plasmid SOS inhibition protein A	-
NX000_RS25420 (92106)	92106..92540	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NX000_RS25425 (92595)	92595..92792	-	198	Protein_109	hypothetical protein	-
NX000_RS25430 (92820)	92820..93053	-	234	WP_000005987.1	DUF905 family protein	-
NX000_RS25435 (93121)	93121..93660	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NX000_RS25440 (93756)	93756..94969	+	1214	WP_139371347.1	IS3 family transposase	-
NX000_RS25445 (94972)	94972..95205	-	234	WP_185681501.1	single-stranded DNA-binding protein	-
NX000_RS25450 (95275)	95275..95355	+	81	Protein_114	hypothetical protein	-
NX000_RS25455 (95538)	95538..95707	-	170	Protein_115	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..117696	117696

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T254953 WP_001372321.1 NZ_CP103331:c91077-90952 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT254953 NZ_CP103331:c91378-91154 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin