Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 74662..74916 Replicon plasmid p2
Accession NZ_CP103331
Organism Escherichia coli strain ZY22049

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NX000_RS25280 Protein ID WP_001312851.1
Coordinates 74662..74811 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 74855..74916 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NX000_RS25240 (70832) 70832..71233 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
NX000_RS25245 (71166) 71166..71423 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
NX000_RS25250 (71516) 71516..72169 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
NX000_RS25255 (72928) 72928..73347 - 420 Protein_75 plasmid replication initiator RepA -
NX000_RS25260 (73340) 73340..73822 - 483 WP_001273588.1 hypothetical protein -
NX000_RS25265 (73815) 73815..73862 - 48 WP_229471593.1 hypothetical protein -
NX000_RS25270 (73853) 73853..74104 + 252 WP_223195197.1 replication protein RepA -
NX000_RS25275 (74121) 74121..74378 - 258 WP_000083845.1 replication regulatory protein RepA -
NX000_RS25280 (74662) 74662..74811 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (74855) 74855..74916 + 62 NuclAT_1 - Antitoxin
- (74855) 74855..74916 + 62 NuclAT_1 - Antitoxin
- (74855) 74855..74916 + 62 NuclAT_1 - Antitoxin
- (74855) 74855..74916 + 62 NuclAT_1 - Antitoxin
NX000_RS25285 (75172) 75172..75246 - 75 Protein_81 endonuclease -
NX000_RS25290 (75492) 75492..75704 - 213 WP_001299730.1 ANR family transcriptional regulator -
NX000_RS25295 (75840) 75840..76400 - 561 WP_000139315.1 fertility inhibition protein FinO -
NX000_RS25300 (76503) 76503..77363 - 861 WP_000704514.1 alpha/beta hydrolase -
NX000_RS25305 (77422) 77422..78168 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..117696 117696


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T254949 WP_001312851.1 NZ_CP103331:c74811-74662 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT254949 NZ_CP103331:74855-74916 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References