Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 82351..82604 | Replicon | plasmid phvKP12-KPC |
| Accession | NZ_CP103319 | ||
| Organism | Klebsiella pneumoniae strain hvKP12 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NXZ72_RS30010 | Protein ID | WP_001312851.1 |
| Coordinates | 82455..82604 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 82351..82410 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXZ72_RS29965 (77384) | 77384..77689 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| NXZ72_RS29970 (77709) | 77709..78074 | + | 366 | Protein_105 | type IV conjugative transfer system protein TraE | - |
| NXZ72_RS29975 (78129) | 78129..78833 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NXZ72_RS29980 (78858) | 78858..79058 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NXZ72_RS29985 (79078) | 79078..79824 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NXZ72_RS29990 (79879) | 79879..80439 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NXZ72_RS29995 (80571) | 80571..80771 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NXZ72_RS30000 (81157) | 81157..81756 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NXZ72_RS30005 (81818) | 81818..82150 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (82351) | 82351..82410 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (82351) | 82351..82410 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (82351) | 82351..82410 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (82351) | 82351..82410 | - | 60 | NuclAT_0 | - | Antitoxin |
| NXZ72_RS30010 (82455) | 82455..82604 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NXZ72_RS30015 (82888) | 82888..83136 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NXZ72_RS30020 (83251) | 83251..83435 | + | 185 | Protein_115 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaSHV-12 / blaKPC-2 | - | 1..83447 | 83447 | |
| - | flank | IS/Tn | - | - | 78129..78833 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254928 WP_001312851.1 NZ_CP103319:82455-82604 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT254928 NZ_CP103319:c82410-82351 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
