Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 82351..82604 Replicon plasmid phvKP12-KPC
Accession NZ_CP103319
Organism Klebsiella pneumoniae strain hvKP12

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NXZ72_RS30010 Protein ID WP_001312851.1
Coordinates 82455..82604 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 82351..82410 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NXZ72_RS29965 (77384) 77384..77689 + 306 WP_004144424.1 type IV conjugative transfer system protein TraL -
NXZ72_RS29970 (77709) 77709..78074 + 366 Protein_105 type IV conjugative transfer system protein TraE -
NXZ72_RS29975 (78129) 78129..78833 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NXZ72_RS29980 (78858) 78858..79058 + 201 WP_072354025.1 hypothetical protein -
NXZ72_RS29985 (79078) 79078..79824 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NXZ72_RS29990 (79879) 79879..80439 + 561 WP_000139328.1 fertility inhibition protein FinO -
NXZ72_RS29995 (80571) 80571..80771 + 201 WP_015059022.1 hypothetical protein -
NXZ72_RS30000 (81157) 81157..81756 + 600 WP_032083981.1 PIN domain-containing protein -
NXZ72_RS30005 (81818) 81818..82150 + 333 WP_152916585.1 hypothetical protein -
- (82351) 82351..82410 - 60 NuclAT_0 - Antitoxin
- (82351) 82351..82410 - 60 NuclAT_0 - Antitoxin
- (82351) 82351..82410 - 60 NuclAT_0 - Antitoxin
- (82351) 82351..82410 - 60 NuclAT_0 - Antitoxin
NXZ72_RS30010 (82455) 82455..82604 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NXZ72_RS30015 (82888) 82888..83136 + 249 WP_000083837.1 replication regulatory protein RepA -
NXZ72_RS30020 (83251) 83251..83435 + 185 Protein_115 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / blaSHV-12 / blaKPC-2 - 1..83447 83447
- flank IS/Tn - - 78129..78833 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T254928 WP_001312851.1 NZ_CP103319:82455-82604 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT254928 NZ_CP103319:c82410-82351 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References