Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 108508..109235 | Replicon | plasmid phvKP12-VIR |
| Accession | NZ_CP103316 | ||
| Organism | Klebsiella pneumoniae strain hvKP12 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NXZ72_RS27820 | Protein ID | WP_011251285.1 |
| Coordinates | 108508..108819 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NXZ72_RS27825 | Protein ID | WP_011251286.1 |
| Coordinates | 108816..109235 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXZ72_RS27780 (NXZ72_27780) | 103519..104013 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| NXZ72_RS27785 (NXZ72_27785) | 104019..104459 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| NXZ72_RS27790 (NXZ72_27790) | 104884..105840 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| NXZ72_RS27795 (NXZ72_27795) | 105900..106241 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| NXZ72_RS27800 (NXZ72_27800) | 106255..106566 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| NXZ72_RS27805 (NXZ72_27805) | 106583..107032 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| NXZ72_RS27815 (NXZ72_27815) | 107866..108303 | + | 438 | Protein_129 | DDE-type integrase/transposase/recombinase | - |
| NXZ72_RS27820 (NXZ72_27820) | 108508..108819 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NXZ72_RS27825 (NXZ72_27825) | 108816..109235 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NXZ72_RS27830 (NXZ72_27830) | 109382..110350 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| NXZ72_RS27835 (NXZ72_27835) | 110422..110787 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| NXZ72_RS27840 (NXZ72_27840) | 110801..111589 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| NXZ72_RS27845 (NXZ72_27845) | 111610..112230 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| NXZ72_RS27850 (NXZ72_27850) | 112649..113284 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| NXZ72_RS27855 (NXZ72_27855) | 113597..114067 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN / rmpA | 1..225067 | 225067 | |
| - | inside | IScluster/Tn | - | - | 101599..125906 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T254926 WP_011251285.1 NZ_CP103316:108508-108819 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT254926 WP_011251286.1 NZ_CP103316:108816-109235 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|