Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5237686..5238281 | Replicon | chromosome |
Accession | NZ_CP103307 | ||
Organism | Pseudomonas aeruginosa strain PLL01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NX763_RS24275 | Protein ID | WP_003113526.1 |
Coordinates | 5238003..5238281 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NX763_RS24270 | Protein ID | WP_003113527.1 |
Coordinates | 5237686..5237991 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX763_RS24235 (NX763_24235) | 5232825..5233673 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
NX763_RS24245 (NX763_24245) | 5233840..5234781 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
NX763_RS24250 (NX763_24250) | 5234898..5235512 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
NX763_RS24255 (NX763_24255) | 5235554..5236138 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
NX763_RS24260 (NX763_24260) | 5236179..5237279 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
NX763_RS24270 (NX763_24270) | 5237686..5237991 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
NX763_RS24275 (NX763_24275) | 5238003..5238281 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NX763_RS24280 (NX763_24280) | 5238334..5238462 | - | 129 | Protein_4795 | integrase | - |
NX763_RS24285 (NX763_24285) | 5238610..5240838 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
NX763_RS24290 (NX763_24290) | 5240908..5241555 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NX763_RS24295 (NX763_24295) | 5241617..5242855 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T254906 WP_003113526.1 NZ_CP103307:c5238281-5238003 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|