Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 5632867..5633476 | Replicon | chromosome |
Accession | NZ_CP103300 | ||
Organism | Endozoicomonas euniceicola strain EF212 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NX720_RS22925 | Protein ID | WP_262597780.1 |
Coordinates | 5632867..5633187 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NX720_RS22930 | Protein ID | WP_262567254.1 |
Coordinates | 5633180..5633476 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX720_RS22895 (NX720_22895) | 5628983..5629162 | - | 180 | WP_262597772.1 | hypothetical protein | - |
NX720_RS22900 (NX720_22900) | 5629335..5629604 | - | 270 | WP_262597774.1 | type II toxin-antitoxin system YafQ family toxin | - |
NX720_RS22905 (NX720_22905) | 5629604..5629867 | - | 264 | WP_262597776.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
NX720_RS22910 (NX720_22910) | 5630249..5630980 | + | 732 | WP_262601641.1 | CRISPR-associated endonuclease Cas1 | - |
NX720_RS22915 (NX720_22915) | 5631051..5631479 | - | 429 | WP_262595354.1 | IS200/IS605 family transposase | - |
NX720_RS22920 (NX720_22920) | 5631545..5632717 | + | 1173 | WP_262597778.1 | transposase | - |
NX720_RS22925 (NX720_22925) | 5632867..5633187 | + | 321 | WP_262597780.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NX720_RS22930 (NX720_22930) | 5633180..5633476 | + | 297 | WP_262567254.1 | NadS family protein | Antitoxin |
NX720_RS22935 (NX720_22935) | 5636168..5636854 | - | 687 | WP_262597781.1 | DUF1887 family CARF protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5631051..5631479 | 428 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12264.07 Da Isoelectric Point: 7.9397
>T254899 WP_262597780.1 NZ_CP103300:5632867-5633187 [Endozoicomonas euniceicola]
MEFVETSVFTKIITQLMSDDDYRVMQETMIAQPDIGSVIKGTGGLRKFRWKLGSSGKRGGVRTIYYWQVSEDTFYMLYAY
TKNRQIDLTSAEKKVLSELARELCNE
MEFVETSVFTKIITQLMSDDDYRVMQETMIAQPDIGSVIKGTGGLRKFRWKLGSSGKRGGVRTIYYWQVSEDTFYMLYAY
TKNRQIDLTSAEKKVLSELARELCNE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|