Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22702..22955 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP103297 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NW892_RS23560 | Protein ID | WP_001312851.1 |
| Coordinates | 22806..22955 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 22702..22761 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS23520 (18517) | 18517..18810 | + | 294 | WP_032146011.1 | hypothetical protein | - |
| NW892_RS23525 (18887) | 18887..19570 | + | 684 | WP_000085883.1 | DNA methylase | - |
| NW892_RS23530 (19571) | 19571..19810 | + | 240 | WP_258917838.1 | hypothetical protein | - |
| NW892_RS23535 (19753) | 19753..20175 | + | 423 | Protein_25 | type-F conjugative transfer system pilin acetylase TraX | - |
| NW892_RS23540 (20230) | 20230..20790 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NW892_RS23545 (20922) | 20922..21122 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NW892_RS23550 (21508) | 21508..22107 | + | 600 | WP_105906770.1 | PIN domain-containing protein | - |
| NW892_RS23555 (22169) | 22169..22501 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (22702) | 22702..22761 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (22702) | 22702..22761 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (22702) | 22702..22761 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (22702) | 22702..22761 | - | 60 | NuclAT_0 | - | Antitoxin |
| NW892_RS23560 (22806) | 22806..22955 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NW892_RS23565 (23239) | 23239..23487 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NW892_RS23570 (23602) | 23602..23780 | + | 179 | Protein_32 | protein CopA/IncA | - |
| NW892_RS23575 (23799) | 23799..24656 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NW892_RS23580 (25595) | 25595..26248 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NW892_RS23585 (26341) | 26341..26598 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NW892_RS23590 (26531) | 26531..26932 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NW892_RS23595 (27181) | 27181..27596 | + | 416 | Protein_37 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | fosA3 / blaTEM-1B / blaCTX-M-55 / rmtB / floR / tet(A) / aph(6)-Id | - | 1..64018 | 64018 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254882 WP_001312851.1 NZ_CP103297:22806-22955 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT254882 NZ_CP103297:c22761-22702 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
