Detailed information of TA system TA254880

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 104084..104353
• Replicon: plasmid unnamed1
• Accession: NZ_CP103296
• Organism: Escherichia coli strain 2e

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: NW892_RS23370
• Protein ID: WP_001323520.1
• Coordinates: 104237..104353 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	104084..104149 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NW892_RS23315	99303..100274	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
NW892_RS23320	100911..101080	+	170	Protein_109	hypothetical protein	-
NW892_RS23325	101263..101343	-	81	Protein_110	hypothetical protein	-
NW892_RS23330	101413..101619	+	207	WP_000275856.1	hypothetical protein	-
NW892_RS23335	101645..102184	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
NW892_RS23340	102252..102485	+	234	WP_000005987.1	DUF905 family protein	-
NW892_RS23345	102513..102710	+	198	Protein_114	hypothetical protein	-
NW892_RS23350	102765..103199	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NW892_RS23355	103196..103958	+	763	Protein_116	plasmid SOS inhibition protein A	-
NW892_RS23360	103927..104115	-	189	WP_001299721.1	hypothetical protein	-
-	103927..104151	+	225	NuclAT_0	-	-
-	103927..104151	+	225	NuclAT_0	-	-
-	103927..104151	+	225	NuclAT_0	-	-
-	103927..104151	+	225	NuclAT_0	-	-
-	104084..104149	-	66	-	-	Antitoxin
NW892_RS23365	104137..104286	+	150	Protein_118	plasmid maintenance protein Mok	-
NW892_RS23370	104237..104353	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
NW892_RS23375	104573..104803	+	231	WP_071586998.1	hypothetical protein	-
NW892_RS23380	104801..104973	-	173	Protein_121	hypothetical protein	-
NW892_RS23385	105043..105249	+	207	WP_000547968.1	hypothetical protein	-
NW892_RS23390	105274..105561	+	288	WP_000107535.1	hypothetical protein	-
NW892_RS23395	105679..106500	+	822	WP_001234426.1	DUF932 domain-containing protein	-
NW892_RS23400	106797..107399	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NW892_RS23405	107720..108103	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaTEM-1B / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / sitABCD	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..108288	108288

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T254880 WP_001323520.1 NZ_CP103296:104237-104353 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

>T254880 NZ_CP103296:104237-104353 [Escherichia coli]
GTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGA
GGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT254880 NZ_CP103296:c104149-104084 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin