Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 9951..10205 Replicon plasmid unnamed1
Accession NZ_CP103296
Organism Escherichia coli strain 2e

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NW892_RS22865 Protein ID WP_001312851.1
Coordinates 10056..10205 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 9951..10012 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW892_RS22815 (5205) 5205..5402 + 198 WP_001324648.1 conjugal transfer protein TrbD -
NW892_RS22820 (5414) 5414..5665 + 252 WP_001038342.1 conjugal transfer protein TrbG -
NW892_RS22825 (5662) 5662..6177 + 516 WP_000809838.1 type IV conjugative transfer system lipoprotein TraV -
NW892_RS22830 (6312) 6312..6533 + 222 WP_001278689.1 conjugal transfer protein TraR -
NW892_RS22835 (6693) 6693..7166 + 474 Protein_12 TraC family protein -
NW892_RS22840 (7164) 7164..7445 + 282 Protein_13 TraX family protein -
NW892_RS22845 (7504) 7504..8364 + 861 WP_000704514.1 alpha/beta hydrolase -
NW892_RS22850 (8467) 8467..9027 + 561 WP_258917833.1 fertility inhibition protein FinO -
NW892_RS22855 (9163) 9163..9375 + 213 WP_001299730.1 ANR family transcriptional regulator -
NW892_RS22860 (9621) 9621..9695 + 75 Protein_17 endonuclease -
- (9951) 9951..10012 - 62 NuclAT_1 - Antitoxin
- (9951) 9951..10012 - 62 NuclAT_1 - Antitoxin
- (9951) 9951..10012 - 62 NuclAT_1 - Antitoxin
- (9951) 9951..10012 - 62 NuclAT_1 - Antitoxin
NW892_RS22865 (10056) 10056..10205 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NW892_RS22870 (10489) 10489..10746 + 258 WP_000083845.1 replication regulatory protein RepA -
NW892_RS22875 (10763) 10763..11014 - 252 WP_223195197.1 replication protein RepA -
NW892_RS22880 (11005) 11005..11052 + 48 WP_229471593.1 hypothetical protein -
NW892_RS22885 (11045) 11045..11527 + 483 WP_001273588.1 hypothetical protein -
NW892_RS22890 (11520) 11520..12377 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
NW892_RS22895 (13316) 13316..13969 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
NW892_RS22900 (14062) 14062..14319 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
NW892_RS22905 (14252) 14252..14653 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..108288 108288


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T254876 WP_001312851.1 NZ_CP103296:10056-10205 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT254876 NZ_CP103296:c10012-9951 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References