Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 4285132..4285825 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | U9ZN09 |
| Locus tag | NW892_RS20550 | Protein ID | WP_000415585.1 |
| Coordinates | 4285529..4285825 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NW892_RS20545 | Protein ID | WP_000650107.1 |
| Coordinates | 4285132..4285527 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS20535 (4280996) | 4280996..4283254 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
| NW892_RS20540 (4283392) | 4283392..4284999 | - | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
| NW892_RS20545 (4285132) | 4285132..4285527 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NW892_RS20550 (4285529) | 4285529..4285825 | - | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NW892_RS20555 (4286030) | 4286030..4286512 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NW892_RS20560 (4286565) | 4286565..4286957 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NW892_RS20565 (4287109) | 4287109..4287768 | + | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| NW892_RS20570 (4287765) | 4287765..4289114 | + | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
| NW892_RS20575 (4289160) | 4289160..4289492 | - | 333 | WP_000914690.1 | DUF2645 family protein | - |
| NW892_RS20580 (4289499) | 4289499..4290209 | - | 711 | WP_000834030.1 | hypothetical protein | - |
| NW892_RS20585 (4290181) | 4290181..4290690 | - | 510 | WP_231364094.1 | Hcp family type VI secretion system effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T254873 WP_000415585.1 NZ_CP103295:c4285825-4285529 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT254873 WP_000650107.1 NZ_CP103295:c4285527-4285132 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|